KEGG   Dickeya fangzhongdai DSM 101947: CVE23_19115Help
Entry
CVE23_19115       CDS       T05277                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
dfn  Dickeya fangzhongdai DSM 101947
Brite
KEGG Orthology (KO) [BR:dfn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CVE23_19115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ATZ95894
UniProt: A0A2K8QQY2
Position
4271677..4272054
Genome map
AA seq 125 aa AA seqDB search
MMNAPRVCIQVQSFYVEAQSQPEEGRFVFAYTITIRNLGRHDVKLLSRYWMITNGNGKQT
EVQGEGVIGLQPVIQPGNEFQYTSGAILETPMGTMEGHYQMIDHQGETFQVPITVFRLAI
PSLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgcgccccgagtgtgtatacaggttcagagcttctatgtagaagcgcagtcc
cagccagaggaagggcgcttcgtgttcgcttacaccatcactatccgcaatctgggtcgt
catgacgtcaaactgctcagccgttactggatgattaccaacggcaacggcaaacaaacc
gaagtacagggcgaaggcgtgatcggcctgcagcccgtgattcaaccgggcaatgaattc
cagtacaccagcggcgccattctggaaacgccgatgggcaccatggaaggccattaccag
atgattgaccatcaaggtgaaacatttcaggtccccattacggtattccgcctggccatt
ccctcactgatacactga

DBGET integrated database retrieval system