KEGG   Dickeya fangzhongdai DSM 101947: CVE23_21190Help
Entry
CVE23_21190       CDS       T05277                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
dfn  Dickeya fangzhongdai DSM 101947
Pathway
dfn00471  D-Glutamine and D-glutamate metabolism
dfn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CVE23_21190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dfn01011]
    CVE23_21190
Enzymes [BR:dfn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CVE23_21190
Peptidoglycan biosynthesis and degradation proteins [BR:dfn01011]
 Precursor biosynthesis
  Racemase
   CVE23_21190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ATZ96261
UniProt: A0A2K8QRZ6
Position
complement(4720316..4721188)
Genome map
AA seq 290 aa AA seqDB search
MATELQGENTISPEAIVSDLPARPTVLVFDSGVGGLSVYDEVRNLLPDLHYIYAFDNEAF
PYGEKPEQFIIERVVSIVDAVEKQHPLSLVIIACNTASTISLPALRARFNFPVVGVVPAV
KPAAKLTRNGVVGLLATRATVQRPYTHELISRFANDCQILLLGSAELVEWGEAKLQGETV
PEDALRKILKPWLKLSEPPDTVVLGCTHFPLLSEELQQVLPDGTRLVDSGSAIARRTAWL
IEHLENPKLSTERNLAYCLSITPKVATLLPVLRRYGFSSLERLTLLPAGE
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaactgcagggcgagaatactatctcaccggaagctatagtttctgattta
cccgcccgccccacggtccttgtatttgattccggggtgggcggtttgtctgtttatgat
gaagttcgcaacctactgccggacttacattatatctacgcctttgataacgaggctttt
ccctacggagaaaagcctgagcaatttatcattgagcgcgtggtgtctatcgttgacgcg
gtggaaaaacaacatccgctgtcattggtcatcattgcctgtaatacagccagtacgatt
tcactcccggcactgcgtgcgcgctttaatttccccgtcgttggtgtggtgcccgcggta
aaaccggctgccaaattgacccggaacggcgtcgttgggttgctggcgacgcgtgccacg
gtccagcgtccttatacgcacgaactgatttcccgctttgccaatgactgtcagattctg
ttgctggggtctgcagagttggttgaatggggggaggccaaacttcagggggaaacggta
cctgaggacgcgttgcggaaaatcctcaagccctggctgaaattgtcggaacccccggat
acggtcgttctgggatgtactcatttccctctgttatcggaagagttgcagcaggtattg
cctgacggcacacggcttgtcgattcgggctccgctattgcgcgcagaacagcatggctg
attgagcatctggagaatccgaaattgtcgacagagcgcaatctggcttactgtttatcg
attacacctaaggtcgcgacactgttgcctgttctgcgccgttatggtttcagttcgctg
gaacgattaacgcttttgcctgctggcgaataa

DBGET integrated database retrieval system