KEGG   Dehalogenimonas formicexedens: Dform_00881Help
Entry
Dform_00881       CDS       T04654                                 

Gene name
fhs
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
dfo  Dehalogenimonas formicexedens
Pathway
dfo00670  One carbon pool by folate
dfo01100  Metabolic pathways
dfo01120  Microbial metabolism in diverse environments
dfo01200  Carbon metabolism
Module
dfo_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:dfo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dform_00881 (fhs)
Enzymes [BR:dfo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Dform_00881 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: APV44224
UniProt: A0A1P8F6W9
Position
811881..813641
Genome map
AA seq 586 aa AA seqDB search
MLDPTKLQDWQIAEESEKSMRPVSRLAAEWGILENELLPYGHYLGKVDYAQVLERLKNES
DGMYIDVTAITPTPLGEGKSTTTIGLVQGLAKRKGNVSGAIRQPSGGPTFNIKGSAAGGG
LSQCIPLTPFSLGLTGDIDCVTNAHNLAMVALTARLQHEANNTDEFLAKRKLPRLNIDPN
NIPMRWAMDFCAQSLRDIIIGLGGKTDGYMMRSGFAISVSSEVMAILAVFTSLRDLRERI
GRIVVAYDRQGNPVTTHDLEVDGAMTAWLVRASNPNLLQTIEGQPVMVHAGPFANIAVGQ
SSIVADRVALKLSDYHVTESGFGADIGFEKFWNIKCRVSGLKPNCAVIVATVRALKMHGG
GPTVKPGKPLDAAYTQPNPVLVEQGAANLVAHIETVKQSSIIPVVCINHFSTDSEEEISI
VKREAERAGARVAVSRHWLLGGEGALELADAVIDACQEKNDFKLLYESSLPLTSRIEKIA
RQVYGADGVSYTPEAKAKAEAIEADASKSDFATCMVKTHLSLSHDPNLKGRPSGWVLPIR
DILTYNGARFVVPVAGDIKLMPGTSSDPAFRRIDVDVETGKVKGLF
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgttagatccaacaaaacttcaggactggcagatagcggaagaatccgaaaagtcgatg
agaccggtatcccggctggcggctgaatggggcattctggaaaatgaactcttgccctac
ggacattatttgggcaaagtggattacgcccaagtactggaacgtctcaaaaatgagtcc
gatggcatgtacatcgacgtcaccgcaatcacccctaccccgctcggcgaaggcaaaagc
accacaacgatcggacttgttcaagggttagccaagagaaaaggcaacgtttcgggggca
atccgccaaccgtccggcgggccgactttcaatattaagggatcggcggccggaggcggg
ctttctcaatgtattcctctgactcctttttcgctcggtttaaccggtgacatcgattgc
gtcactaacgcgcacaatctcgctatggtagctttgactgcccgattacagcacgaagcc
aacaacaccgacgaatttttggcaaaacgcaagctacccaggctgaatatcgatcccaat
aatattccaatgcgatgggccatggatttctgcgctcaatcattgcgggatatcatcatc
gggctcggcggcaaaaccgatggttacatgatgcgctcgggctttgccatatcggtaagt
tcggaggtcatggctattttggcggtgttcaccagccttcgtgacctgcgcgagcgcatc
ggacgcatcgtcgtcgcctatgatcggcagggcaatccggtcactacccacgaccttgaa
gtcgatggagcgatgactgcctggctggtccgggcttcaaatccgaatcttctccagaca
attgaaggacaacccgtgatggtccacgccgggccgttcgccaacatcgccgtcggccag
tcttctatcgtcgccgacagagtcgccctgaaattatctgattaccatgtaactgaaagt
ggctttggcgccgacataggctttgaaaaattctggaacatcaagtgccgggtcagtgga
ttgaaacctaattgcgccgtaattgttgccacggtgcgcgccctgaagatgcacggaggc
ggtccgactgttaaaccgggtaaaccgctggacgcagcgtacacccagcctaacccggtt
ctcgttgagcagggggcggcaaacctcgtcgcccacattgaaacggtgaaacagtcaagt
attatcccggtggtttgtatcaatcatttctcaacggattccgaagaagaaatctccatc
gtcaaaagagaagctgaacgcgccggagccagggtcgccgtctcgcgccattggctcctg
ggcggtgaaggcgccctcgagctggcggacgcggttatcgatgcctgccaagagaaaaat
gacttcaagttgttatacgaaagctccttgcccctgacctcccgcatcgagaagatcgca
aggcaggtgtacggtgccgatggggtatcctacacgccggaagccaaagctaaagccgaa
gccatcgaagctgacgcttccaaatcggattttgctacctgcatggttaagacccacctg
agtttgtctcacgatcccaacttgaaaggccggccttccgggtgggttcttcctatacgg
gatatccttacatataatggcgccagatttgttgtcccggtggccggagatattaaattg
atgccggggacgtcttccgaccctgcattccgccgcatcgatgtcgatgtcgaaacaggc
aaagtcaaaggcctgttttag

DBGET integrated database retrieval system