KEGG   Dehalogenimonas formicexedens: Dform_00914Help
Entry
Dform_00914       CDS       T04654                                 

Gene name
acsB
Definition
(GenBank) acetyl-CoA synthase
  KO
K14138  acetyl-CoA synthase [EC:2.3.1.169]
Organism
dfo  Dehalogenimonas formicexedens
Pathway
dfo01100  Metabolic pathways
dfo01120  Microbial metabolism in diverse environments
dfo01200  Carbon metabolism
Brite
Enzymes [BR:dfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.169  CO-methylating acetyl-CoA synthase
     Dform_00914 (acsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CdhC CODH_A_N
Motif
Other DBs
NCBI-ProteinID: APV44255
UniProt: A0A1P8F746
Position
847571..849754
Genome map
AA seq 727 aa AA seqDB search
MSTIIATAAINGAHQLVDRAESAWRNALVTKGSGQPVGFPNTAYFLPVIYGVTGQKVETL
GDVAHAIAKCREMLPPVMKPEDALLSLDPVLNAGMAALFAEEIIEAIRYLEQPDYYTKTE
DPIDDNIWLGAADDVILRKRGVEFVDGTAPGFAAILGAAPSDEIAVKIATELQQKNLYTF
MSAASGDQLLARQLLRSGIQVGWPTRLVPFGPDTSSTVFGIGFAVRVALSFGNVIPGQAK
SLFEYCKNRVYAFVMALGEVSEEWAATAAGALNFGFPVIADSAIPEIPNAIVSNVSQDKI
VNRAIDVRGLKIVINEVPVPVAYGPAYEGERVRGEDIYLECGGGRTPMVEWVTSRPIDEV
TDGAVEVSGPELDEVPAGSKLPLAIVVEVAGRQMQDDYEPILERQIHHLINYAQGVMHIG
QRDIAWLRVSKGAVEKGFRLSHIGKLLHAKLHQDFGRIFDKMQVTLYTRTEDVLAIVAKA
KEAYAARDARIEGMTDESVETFYSCLLCQSFAPSHVCVISPERTGLCGSYNWMDCKASFD
INPIGPNQPVSKGQTLDPRLGQWKGVNEYVFKASRGNVDHYNFYSIISDPMTACGCMECI
SAILPLCNGVMTVNREYTDMTPCGMKFTTLAGTIGGGVTTPGFVGHSKYNITQRKFLAAE
EGIKRLVWMPRSLKEEIADLFNERANEIGIPDLLNRVADETVGTTEEAILSFLTEMNHPA
LSLDPLL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgattattgccactgctgccataaacggcgctcaccagttggtagaccgggct
gaatctgcctggcggaacgctctggtaaccaaaggtagcggccaaccagtcggtttccca
aatacggcttacttccttccggtaatttacggcgtaaccggtcaaaaagtagagaccctc
ggcgatgtggcacacgcaatagccaaatgccgcgagatgctgcctccggtcatgaaacct
gaggacgctctcttatcactggatccggtgctcaatgccggcatggcggctctgttcgcc
gaagagatcattgaggcgatccgatacctggaacagcctgattattacaccaagaccgag
gatccgattgacgacaatatctggcttggcgccgccgatgacgtcatcctgagaaaaagg
ggcgtcgagttcgttgacgggaccgcccctggttttgctgctattcttggcgcggcgccc
tccgatgaaatcgccgtaaaaattgcgactgaactgcagcagaaaaacctctataccttt
atgagcgcggccagcggcgaccaactattagcgcggcagttactgcgttctggcatccag
gtcggctggccgacccggctggtgcccttcggtccggacacctcgtcgaccgttttcggg
atcggctttgccgtgcgagtcgccctctcttttggcaacgtcattccggggcaggcgaag
agcttgtttgaatactgcaaaaacagggtttacgcctttgtgatggctcttggcgaagtg
agcgaagaatgggcggctaccgcggcgggtgctctcaacttcggctttccggttattgcc
gattctgccattcccgaaattccaaatgccatcgtatcgaatgtttctcaagataaaatc
gtcaaccgggcgatcgatgtccgtgggctcaagatcgtgatcaacgaagtcccggtcccg
gtggcttacggccctgcttacgaaggtgagcgtgtcaggggtgaagacatctaccttgaa
tgcggtggcgggcgcacgccgatggtagagtgggtaacttcaaggccgatcgacgaagtc
actgacggtgcggttgaagtcagtggacctgaattagatgaggttcccgccggcagcaaa
ctgccgttggccatcgttgtcgaagtcgccggaaggcaaatgcaggacgattacgagccc
attctggaaaggcagatccatcacctcatcaattacgcccagggtgtcatgcacatcggc
cagagggatattgcatggttaagggtgagcaaaggggcggttgaaaaagggttcaggctg
agtcatatcggaaaattgctccacgccaagttgcaccaggatttcggccgcatcttcgat
aaaatgcaggtaaccctttacacccgcaccgaggacgtgctggcgatcgttgccaaagcc
aaagaggcctacgccgctcgtgatgcccgcatcgagggaatgaccgatgaatctgtggag
accttttattcctgcctgttgtgccagtccttcgccccgtcccatgtatgcgtgatcagt
ccggaacggaccgggctctgcgggtcctacaactggatggattgcaaggcatcctttgac
atcaaccccatcggtcccaaccagccagtatccaaaggccagactctcgacccgcgcctg
ggccagtggaaaggcgttaacgaatatgttttcaaagcgtcgcggggtaacgtggaccat
tataatttttacagcatcatatcggatcctatgaccgcctgcggctgtatggaatgcatt
tccgccatactccccttgtgcaacggagttatgacggtcaaccgagaatacaccgatatg
acgccctgcggtatgaaattcaccacgctggccgggaccatcggcggcggcgttactaca
cccggtttcgtggggcattccaagtacaatatcacccaacggaaattcctggccgccgaa
gaggggattaagcggctggtctggatgccccgttcccttaaagaagagatcgccgatctt
tttaacgagcgggcaaacgagattggcatcccggatctattgaaccgggttgccgacgag
accgttggtacgacggaagaggccattctttccttcctgaccgagatgaatcacccggcg
ctctcgttagatccgctgttataa

DBGET integrated database retrieval system