KEGG   Deinococcus geothermalis: Dgeo_0566
Entry
Dgeo_0566         CDS       T00353                                 

Name
(GenBank) diguanylate cyclase
  KO
K18967  diguanylate cyclase [EC:2.7.7.65]
Organism
dge  Deinococcus geothermalis
Brite
KEGG Orthology (KO) [BR:dge00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dgeo_0566
Enzymes [BR:dge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Dgeo_0566
SSDB
Motif
Pfam: GGDEF 5TM-5TMR_LYT ECF_trnsprt
Other DBs
NCBI-ProteinID: ABF44868
UniProt: Q1J0W6
Position
complement(604158..605207)
AA seq 349 aa
MLSAFFVNFCILVTFTSIGSLTYTGREDYHTLRRALRYLISVLAGIILVLYGVPLMEGVR
VDFRGVPILLAGLFGGPLPALAVALPIMAYRLWAGGTGAHAGVLSILLVALCAGMLHARF
AQNRLTWRDAWVPFAIFALANLSILLVPSAGPQLLRTAWLPVTLLQGLATLVAFTVVSLR
FRTVGHTATLRGIAYLDALTNLHNRRQFDEDLPAFGIEEGTFLLLLDLDRFKALNDSCGH
PFGDRVLRELAVLLQQGVRGTDRVYRLGGEEFAVLLRQTSPTGAARVAERLRSQVREQLG
TRVGRPDLTITISAGLTPCTADPDTTVRTADHLLYEAKRSGRNRIATAV
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgctctccgccttcttcgtcaacttctgcatcctggtgacattcaccagtatcggcagc
ttgacctacaccgggcgggaagattaccacacgctgcggcgggcgctgcgctacctcatc
agcgtcctggcggggatcatcctggtgctgtacggcgtgccactgatggagggcgtgcga
gtggacttccgaggagtcccgattctgctcgcaggcctctttggtggccctcttcccgca
ctcgccgtcgcccttccgatcatggcctaccggctgtgggcaggcggcacgggggcccat
gccggcgtcctgtctattctcctggtggcgctctgcgccggcatgcttcatgcccgtttt
gcccagaatcggctgacctggcgtgacgcttgggtccccttcgcgatcttcgcgctcgcg
aacctgtccattctgctggtgcccagcgccggcccccagctgctcagaaccgcgtggctc
ccggtgaccctgctccaaggcctggccacgctggtggcctttaccgtggtcagcctccgc
tttaggacagtcggccacacagcgaccctccgaggcatcgcctacctcgacgcgctcacc
aacctccacaaccggcgccagttcgacgaggatctgcctgcctttggcattgaggagggg
acctttctgctgctgctcgacctcgaccgcttcaaggccctcaacgactcgtgcggtcat
cccttcggggaccgggtcttgagagaactcgcagtgctgctgcaacagggcgtgcggggt
acggaccgggtttaccgcctgggcggagaggagtttgctgtcctgctgcgtcagacctcg
cccaccggtgcggcccgcgtggccgagcggctgcggtcgcaggtccgggagcaactgggc
acacgggtcggacggcctgacctcaccatcaccatttcggcgggtctgacgccctgcact
gcagatccagatacgaccgtacgcactgccgatcacctgctctacgaggcaaagcgctca
ggacgtaaccgaattgcaacggctgtctga

DBGET integrated database retrieval system