KEGG   Deinococcus geothermalis: Dgeo_0584Help
Entry
Dgeo_0584         CDS       T00353                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
dge  Deinococcus geothermalis
Pathway
dge00340  Histidine metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01230  Biosynthesis of amino acids
Module
dge_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Dgeo_0584
Enzymes [BR:dge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Dgeo_0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABF44886
UniProt: Q1J0U8
Position
complement(621484..622977)
Genome map
AA seq 497 aa AA seqDB search
MPMQVLQGDAARAALTRSFGEIPVPESVLARIEATFGEPLTPEEVVARILADVRARGDEA
LLDWTEKLDGARPEALEVTREEIEAAQVDPALHDAIRLAAARVRAFYEQQPAHGFLDHGP
DGALGQLVRPLSRVGVYVPGGLAPLISTLIHTVVPAQVAGVPEIIVTTPPGRDSRVNPAI
LVAAREVGVNRIFRVGGAQAIGAFAYGTASVPAVDKIAGPGNLFVVIAKRMVYGAAGIES
LPGPTETLVVADDSADPRFVAADLLAQAEHLGAEPVLVSTSRDLLVEVQNKLNGQLEALP
EPNRSWARDSVLSRMKVVLAADLAEALDLANLYAPEHLCLLTRDPWSLLGQVRRAGGVFV
GEASMEALGDYVAGPSHVMPTGGTARFMSPVNVRDFQNIISVVGVNEAALRRIGPPAARL
ARAEGLEAHARAIESRLTPEVPEAHPEATLKVLEEAALDKDGGQGLEQVERVRTTPPVDQ
PLSTQTPPSKTRRRNDS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgcaagtccttcaaggtgacgccgcccgcgcggccctgacccgctcctttggt
gagattcctgttccagaaagcgttttggcccgcattgaggccacctttggcgaacccctc
acgccggaggaggtggtggcgcgcatcctcgcagacgtgagggcacgcggcgacgaggcc
ctgctcgactggaccgaaaagctggacggcgcccgtcccgaggcgcttgaagtgacgcgg
gaagagatcgaggcggcgcaggttgaccccgcgttgcatgacgcaatccgcctcgccgct
gcgcgcgtccgggccttttacgagcagcagcccgcccacggctttctggatcatggtccg
gatggagcactgggccaactggtgcgcccgctctcgcgggtcggcgtgtatgtgcccggc
ggcctggcacccctcatcagcacgctgattcacacggtggttccggcacaggtggcaggc
gtgccagaaatcatcgtgacgacgccaccaggacgggacagccgggtgaatccggccatc
ctggtggcggcgcgggaggttggggtgaaccgcatcttccgagtaggcggcgcccaggcc
attggcgccttcgcctacggcaccgccagcgtccctgctgtggataaaattgccgggccg
ggcaacctctttgtggtgattgccaagcgaatggtctacggcgcggcgggtatcgagagc
ctgcccggcccgaccgagacactggtggtggcagacgactctgccgacccgcgctttgtg
gcggcggacctgctggcccaggccgaacacctgggggccgaacctgtgttggtgtccacc
agccgcgacctgctggtggaggtgcaaaacaagctgaacggacaactggaagcgctgccc
gaacccaaccggagttgggcgcgtgacagcgtgctcagccgcatgaaggtggtgctggcc
gccgacctcgcggaggccctcgacctcgccaacctctacgcccccgaacacctttgcctg
ctgacccgcgacccctggagcctgctggggcaggtgcgccgagcaggcggcgtctttgtg
ggcgaggcgagcatggaggctctgggcgactatgtggccggccccagccacgtcatgccc
accggcggcaccgcccgctttatgagtccggtcaatgttcgcgactttcagaacatcatc
agtgtggtcggcgtgaacgaggcagcgctgcgccgcatcggccctcccgccgcccgcctc
gcccgcgccgagggcctagaagctcacgcccgcgcgatcgaaagccgcctgaccccagag
gtgcccgaggcgcacccggaggcaacactgaaggtgctggaggaggccgcactggataag
gacggaggacaaggcttagagcaggtcgagcgggtgcggacaactcccccggtggatcag
cccctctctacccaaaccccgccttccaagacccgaaggcgtaacgactcctaa

DBGET integrated database retrieval system