KEGG   Deinococcus geothermalis: Dgeo_0761Help
Entry
Dgeo_0761         CDS       T00353                                 

Definition
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
dge  Deinococcus geothermalis
Brite
Enzymes [BR:dge01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     Dgeo_0761
Transfer RNA biogenesis [BR:dge03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    Dgeo_0761
 Prokaryotic type
    Dgeo_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2
Motif
Other DBs
NCBI-ProteinID: ABF45063
UniProt: Q1J0C1
Position
complement(825177..826115)
Genome map
AA seq 312 aa AA seqDB search
MPVIPVDKPLGLTSHDVVNRARRARGTRRVGHTGTLDPLATGVLVLCVDDSTKLVQFMEA
DSKEYLAWIALGGTSPTLDAEGPLTEVVPVSPPSEEEARAVLAGFVGPQAQVPPQYSAIQ
VGGQRAYAVARAGGALDLPARNIVIHALELLGISNRMAESPRTFARSSEGWTPDPTGRTF
TLPEPLGEFPTLLVRASVSSGTYLRSLARDVGAALGVPAHLAGLVRTRVGRYDLADSVSV
EDLAGAEGFPNLAALDLPRMEADEPLARALRQGKRPRSAVVGRHVVTRDGELVAVVDGDG
KELRVVRAWAGA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgccagtcatccctgtggacaaacccttgggcctaacctctcacgacgtggtgaaccgg
gcgcgccgcgcacgcgggacgcggcgagtcggccacaccggtaccctggacccgcttgct
accggggtgcttgtgctgtgtgtggacgactccaccaaactggtgcagttcatggaggca
gacagcaaggagtacctcgcctggattgccctgggcggcacctcccccaccctcgacgcc
gagggacccctgaccgaggtcgtgccggtttcccccccctccgaggaggaggcgcgggcc
gtgctggcggggttcgtggggccacaggcacaggtgccgccgcaatacagcgcaatccag
gtcgggggacagcgggcctacgcggtagcgcgggccggaggcgcgctggacctgcccgcg
cggaacatcgtcattcacgcgttagagctgctcggcatctccaaccggatggcggagtct
ccccgcaccttcgcgcgtagctccgagggctggacaccagacccaaccggacgcaccttc
accctgcccgaaccactgggcgagtttcccaccctgctcgtccgcgccagcgtcagcagc
ggcacctacctgcgctcgctcgcgcgggacgtgggagcagcgctgggcgtgcccgcacac
ctggctggcctcgtccgcacccgggttggccgctacgatctggccgacagtgtgagcgtg
gaagacctggcgggggcagagggtttccccaacctcgccgccctggacctgcccaggatg
gaggccgatgagccgctggcccgcgcactgcggcagggcaaacgcccaaggtcggcggtg
gtggggcggcacgtcgtcacccgggacggtgagttggtcgcggtggtggacggcgacggg
aaagaactgcgggtggtgcgggcctgggcgggggcataa

DBGET integrated database retrieval system