KEGG   Deinococcus geothermalis: Dgeo_0912Help
Entry
Dgeo_0912         CDS       T00353                                 

Definition
(GenBank) NADH dehydrogenase subunit D
  KO
K00333  NADH-quinone oxidoreductase subunit D [EC:7.1.1.2]
Organism
dge  Deinococcus geothermalis
Pathway
dge00190  Oxidative phosphorylation
dge01100  Metabolic pathways
Module
dge_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dge00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dgeo_0912
Enzymes [BR:dge01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     Dgeo_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Complex1_49kDa NiFeSe_Hases
Motif
Other DBs
NCBI-ProteinID: ABF45214
UniProt: Q1IZX0
Position
973063..974274
Genome map
AA seq 403 aa AA seqDB search
MTTEPLTPPTSGALLHTEIMSLNVGPQHPSTHGVLRLVVDMDGEYVTRVTPHMGYLHTGF
EKTFEHRTYHQGVTYAPRTDYLHCFGHELAYVLSVEKLLGAEVPERATTVRVMLHELGRI
HSHLVFVGTGLLDLGALTPFFYAFREKEAVQDLFEAVCGYRMNQGYFRVGGLARDIPEDW
PARVAAFLDTFERGVDEYETLFAKNPIFLDRAKGVGVIPRDVAIDLGLTGPNLRASGVPL
DHRKANPYCGYETYDFEVPVSQAGDSLARFQLRLLELRESAKIIRQALKRLTPGPIKDPN
RKISLPPRSELETSMEAVIHHFKLVTEGFHPPKGEVYVPTESARGEVGYYIVSDGGSMPY
RVKIRAPSFVNLQALEYACVGGQFADLITILASIDPVLGDVDR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggaacccctcaccccccccaccagcggcgccctgctccacaccgagatcatg
agcctgaacgtggggccgcagcatccttccacacacggtgttctgcggctggtggtggat
atggacggcgagtacgtcacgcgggtcacgccgcatatggggtacctccacaccggcttt
gagaagaccttcgagcaccgcacctaccaccagggcgtcacctacgcgccgcgcaccgat
tacctgcactgctttggacacgaactcgcctatgtcctgagtgtggaaaagctgttgggg
gccgaggtgccggaacgcgcgaccaccgtgcgggtgatgctgcatgagctgggccgcatc
cactcgcacctcgtctttgtgggcacaggcctgctcgacctcggcgcgctgacgcccttc
ttctacgcctttcgcgagaaggaggcggtgcaggacctgtttgaggccgtgtgtggctac
cggatgaaccagggctactttcgggtgggtggcctcgcgcgcgacatcccggaagactgg
cctgcccgcgtcgctgccttcctcgacaccttcgagcgcggagtggacgagtacgagacg
ctatttgccaagaatccgatctttctcgaccgtgcgaagggggtcggcgtgattccgcgt
gacgtggcgatcgacctgggcctgactgggccgaacctgcgggcctcgggtgtgccactt
gaccaccgcaaggccaacccctactgcggctacgagacctacgacttcgaggtgccggtg
agtcaggccggagacagcctggcgcgctttcagctgcggctgctggagttgcgcgagagc
gcaaagattatccggcaggccctgaaacgcctcacgcctggccccatcaaggaccccaac
cgcaagatttcgctgccgccccgctccgaacttgaaaccagcatggaggcggtcatccac
cacttcaagctggtgacggaaggctttcatccccctaagggcgaagtgtacgtgccgacc
gaatctgcccgcggcgaggttggctattacatcgtctcggacggcggctcgatgccctac
cgggtgaagatccgcgcgcccagctttgtgaacctgcaagccctcgaatacgcctgcgtg
ggaggacagttcgcggacctgatcacgattctggcgtcgatcgatccggtgctgggagac
gtggaccggtga

DBGET integrated database retrieval system