KEGG   Deinococcus geothermalis: Dgeo_1141Help
Entry
Dgeo_1141         CDS       T00353                                 

Definition
(GenBank) gamma-glutamyltransferase 2. Threonine peptidase. MEROPS family T03
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
dge  Deinococcus geothermalis
Pathway
dge00430  Taurine and hypotaurine metabolism
dge00460  Cyanoamino acid metabolism
dge00480  Glutathione metabolism
dge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dge00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Dgeo_1141
   00460 Cyanoamino acid metabolism
    Dgeo_1141
   00480 Glutathione metabolism
    Dgeo_1141
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dge01002]
    Dgeo_1141
Enzymes [BR:dge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Dgeo_1141
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Dgeo_1141
Peptidases and inhibitors [BR:dge01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Dgeo_1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ABF45438
UniProt: Q1IZ96
Position
complement(1212264..1213859)
Genome map
AA seq 531 aa AA seqDB search
MTYQPETPVIRQAVYAQRGMVATSQPLAAQAGLSILQQGGNAVDAAIATAAALTVVEPTS
NGLGGDLFALVWARGELHGLNASGAAPAALTRDVLAGGDMPRHGWTPVTVPGAVRGWADL
HARFGRLPFADVLLPAIRYAREGYPLSPVLAAHWTRAIRSYRGLQLPILEEWFRVFAPDG
FTPAPGALWRSEDHARTLEAIARTAGADFYEGKLAQQIDAHARETGGLLRAADLAAHRSE
WVNPIYTRFLDHLVYEIPPNGQGIAALIALNILDELDLPDRRDDPRGLHLQIEAMKRGFH
DAHTFVGDPRHVPVDVEGLLSAENAATHRTFLGELAHDPATRAPSSGGTVYLATADGEGG
MVSLIQSNYMGFGSGVVVPGTGIALHNRGHNFHLDPAHPNALAPGKRPYHTIIPGFLSRA
DGTPLGPFGVMGGFMQPQGHVQVVLNTLRYGLNPQQALDAPRWQWLQGKAVDLEPALGAQ
LARALAARGHDVRLQLDSSAFGRGQIIWRNPHTGVLEGGTESRTDGHIAVW
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgacctaccagcccgagactccagttattcggcaagcggtgtacgcgcagcgcggcatg
gttgccaccagccagccccttgccgcccaagccgggctcagcatcctgcagcagggcggc
aacgccgtcgacgcggccatcgccaccgccgccgcgctgacggtcgttgaacccaccagc
aacgggctgggcggcgacctcttcgccctggtgtgggcaaggggcgagctgcacggcctg
aatgccagcggcgccgcccccgctgccttgacccgcgacgtgttggccggcggtgacatg
cccagacatggctggacccccgtcaccgtccccggcgcggtccgcggttgggccgacctg
cacgcccgctttggccgcctccccttcgccgacgtcctgctccccgccatccgctatgcc
cgcgagggctaccccctctcgccggtcctcgccgcacactggacacgcgccatccgcagc
taccggggcctgcagctccccatcctggaggagtggttccgggtcttcgccccagacggt
ttcacccctgcccccggggcactctggcgcagcgaagaccacgcccgcaccctagaggcc
attgcccggacagcaggcgcggacttctacgagggcaagcttgcccagcagatcgacgcc
cacgcccgcgagacgggcggtctgcttcgcgccgccgacctcgccgcccaccgctccgag
tgggtgaaccccatctacacccgcttccttgaccacctcgtctatgagatcccacccaac
gggcagggcatcgctgcactgatcgccctgaacatcctggacgaactcgacctccccgac
cgccgcgacgatccccgggggctgcacctccagatcgaggcgatgaaacgcggcttccac
gacgcccacacctttgtcggtgacccgcgccatgtgccggtggatgtggaagggctcctc
tccgccgaaaacgccgccacccaccgcaccttcctgggtgagctggcccacgaccccgcc
acccgcgcccccagcagtggcggcaccgtctacctcgccaccgccgacggcgagggagga
atggtcagcctcatccagagcaactacatgggctttggcagcggcgtggtcgtgcccggc
accggcatcgccctccacaaccgcggccacaacttccacctcgaccccgcccaccccaac
gccctcgcgcccggcaaacggccctaccacaccatcatccccggcttcctgtcacgcgca
gacggcaccccgctcggccccttcggggtgatgggcggcttcatgcaaccgcagggccat
gttcaggtcgtgctgaacaccctccgctacggcttgaatccccagcaggccctcgatgcc
ccgcgctggcagtggctccagggcaaggctgtagaccttgaacccgccctcggcgcacag
ttggcacgggccctcgccgcccgtgggcatgacgtgcgcctccagctcgactccagcgcc
tttggccgcggccagatcatctggcgcaacccccacaccggcgtgctggaaggcggcaca
gaaagccgcacggacggacacatcgccgtgtggtaa

DBGET integrated database retrieval system