KEGG   Deinococcus geothermalis: Dgeo_1174Help
Entry
Dgeo_1174         CDS       T00353                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
dge  Deinococcus geothermalis
Pathway
dge00250  Alanine, aspartate and glutamate metabolism
dge00330  Arginine and proline metabolism
dge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dgeo_1174
   00330 Arginine and proline metabolism
    Dgeo_1174
Enzymes [BR:dge01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     Dgeo_1174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Adeno_PIX
Motif
Other DBs
NCBI-ProteinID: ABF45471
UniProt: Q1IZ63
Position
1246690..1248267
Genome map
AA seq 525 aa AA seqDB search
MTSTLMEGFLPFTHEPYFNFAQEDVAQKQREAYRQVREKYVGRSFPMMLCGKPVEGEDTF
EVHNPADTRETVWRFPKASPAQLEQAIACAKAAFEEWRFSDPLQRAAIFKRAAELLRTRR
MEFNAVMGLENGKNWAEADGEIAECVDHFEVFARETLRWAQGKPVYPMPDEHVTMVYEPI
GVVAVISPWNFPAAIPLGMSLGAIAAGNTVVWKPASETPLSSLLLVELLFEAGLPRNVIQ
FLTGTDEVLGDPLVDHKDIRMIAFTGSKEIGCRIMERAAKVQPGQKWLKRVMAEMGGKDP
TVVCADADLDDAARGIVQAAFGYSGQKCSACSRVIAEDSVYDELLDKVVRLTRELKVGLP
EENAPLGPVIHEDSANRILASIERGKKTAHLVLGGERADSGGREGGYLQPTIFADVDPRD
PLFQEEIFGPVLSFTRARDWRHAIDLANDSEYGLTAAFYSRDPQKIAEARRLIHVGNLYV
NRKCTGALSGTHAFGGYGMSGTNAKVGGPDYLFWFLQTKTVAQKY
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcacgttgatggagggcttcctcccatttacgcatgagccgtacttcaacttt
gctcaggaagacgtggcgcaaaagcagcgcgaggcctaccggcaggtgcgcgaaaaatac
gtaggccgcagcttcccgatgatgctgtgtggcaaacctgtggagggcgaggacaccttc
gaggttcacaacccggcggacacccgcgagacggtctggcgcttcccgaaggcctcgccc
gcgcaactggagcaagccattgcctgcgccaaagccgcctttgaggagtggcgtttcagt
gacccgctgcagcgcgcggccatcttcaagcgggcggcggagctgctgcgcacccggcgg
atggagttcaacgcagtcatgggcctcgagaacggcaagaactgggccgaggcggacggc
gagatcgccgagtgcgtagaccacttcgaggtcttcgcccgcgagacgctgcggtgggcg
caggggaagccggtctacccgatgcccgacgagcacgtgacgatggtgtacgagccgatc
ggcgtcgtcgcggtgattagcccctggaatttcccggcggcgattccgctgggcatgagc
ctaggcgcgatcgcggcgggcaacaccgtggtgtggaaacccgcctccgagacgcccctc
agcagcctgctgctggtggagctgctcttcgaggcgggcctgccgcgcaacgtcattcaa
tttctgaccggtacggacgaggtgctgggtgatccgctggtcgaccacaaagacatccgc
atgatcgcctttaccggctccaaggagattggctgccgcatcatggagcgcgcggcgaag
gtgcagccagggcaaaaatggctcaagcgcgtgatggccgagatgggcggcaaggacccc
acggtggtctgcgccgacgccgatctggacgacgccgcacggggcatcgtgcaggcggcc
ttcgggtattcgggccaaaagtgcagcgcgtgcagccgggtgattgccgaggacagcgtg
tatgacgagctgctggacaaggtcgtgcggctcacccgcgaactgaaggtcggcttgccg
gaggagaatgcccccctcggcccggtcatccacgaggacagcgcaaaccgcatcctggcc
tctatcgaacggggcaagaaaacggcccatctggtgctgggcggcgaacgcgctgacagc
gggggccgcgagggcggctacctccagcccaccatcttcgcggacgtggacccacgcgat
cccctctttcaggaggagattttcgggccggtgctgagctttacccgggcgcgcgactgg
cggcacgcgatcgacctcgccaacgactcggagtacggcctgaccgccgctttctatagc
cgcgatccccaaaagattgcggaggctcggcgcctgatccacgtcggcaacctgtatgtc
aaccgcaagtgcaccggcgccctgtcgggtacccacgccttcggcggctacggcatgagc
ggcacgaacgccaaggtgggcggccccgattacctcttctggttcctccagacaaagacg
gtggcacagaagtactga

DBGET integrated database retrieval system