KEGG   Deinococcus geothermalis: Dgeo_1451Help
Entry
Dgeo_1451         CDS       T00353                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dge  Deinococcus geothermalis
Pathway
dge00260  Glycine, serine and threonine metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
dge01130  Biosynthesis of antibiotics
dge01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dgeo_1451
Enzymes [BR:dge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Dgeo_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1 HopA1 B12-binding TraT
Motif
Other DBs
NCBI-ProteinID: ABF45746
UniProt: Q1IYD8
Position
complement(1538020..1539057)
Genome map
AA seq 345 aa AA seqDB search
MTATLPATTRPHVIADLRSDTVTTPTPEMREAMAQAPVGDDVYGEDPTVNALQAEVARLT
GHEAGLFMPSGTMTNQVAIALHTRRGEEVICAEGSHIYEWELGMMATFSGVVPRFVPAPL
GVPDPEAVRLAVRRSVHQSPTGLISLENTHNKAGGTVIPLDVLAAIRHVADDEGLPLHLD
GARVFNAAAALDVPVSEITRQFDTVSVCLSKGLGAPVGSVLVGSAAAMQQAHRYRKMMGG
GMRQAGVLAAAALIALRDGPARLKEDHRRARILAEALAEAGFDVDLAAVQTNMVYVTLPD
AAAQVARWASLGVLASALGPDSVRFVLHHQISDAALAEALHVLTA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccctgcccgcgacgacccggccccacgtgatcgccgacctgcgctccgac
accgtgaccacgccgacgcccgagatgcgcgaggcgatggcacaggctccggtcggggat
gacgtgtacggcgaggatcccaccgtcaatgccctgcaggcggaagtcgcgcgcttgacc
ggacatgaggcgggcctctttatgcccagcggcacgatgaccaaccaggtggcgatcgcc
ctgcacacccgccgcggcgaggaggtcatttgcgccgagggatcgcacatctatgagtgg
gaacttgggatgatggcgaccttttccggcgtggtgccgcgcttcgtgcccgccccgctg
ggggtgccggaccccgaagcagtgcgtttggcggtgcggcgctcggtccaccagtcgccc
accgggctgatcagcctcgagaacacccacaacaaggcgggcggtacagtgattccgctg
gacgtgctggccgccattcgtcatgtcgcggacgacgagggcctgccgctgcacctcgac
ggggcgcgggtgttcaacgcagcagcggccctggacgtgcccgtctcggagatcacccgg
cagtttgacacggtgagtgtctgcctcagcaaggggctgggggcgccggtcgggagcgtg
ctcgtgggcagtgccgccgccatgcagcaggcgcaccgctaccgcaagatgatgggcggt
gggatgcggcaggccggggtgctggctgccgccgcgctgatcgctctgcgggatggtccc
gcccggctgaaggaggaccaccgccgcgcccggattctggccgaggcgctggctgaagcg
gggtttgacgtggacctcgccgccgtgcagacgaacatggtctatgtgaccctgccggac
gcggcggcgcaggtggcgcgctgggcttcgctgggcgtgctggcgagcgcacttggcccg
gactcggtgcgcttcgtgctgcaccaccagatcagtgacgcggcgctggcagaggccctc
cacgtgctgacggcatga

DBGET integrated database retrieval system