KEGG   Deinococcus geothermalis: Dgeo_1624Help
Entry
Dgeo_1624         CDS       T00353                                 

Definition
(GenBank) Small GTP-binding protein domain
  KO
K03596  GTP-binding protein LepA
Organism
dge  Deinococcus geothermalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU LepA_C EFG_C GTP_EFTU_D2 EFG_II MMR_HSR1 RF3_C SRPRB Ras
Motif
Other DBs
NCBI-ProteinID: ABF45919
UniProt: Q1IXW5
Position
1726772..1728559
Genome map
AA seq 595 aa AA seqDB search
MNVRNFSIIAHVDHGKSTLADRILERLGAMGERDKRDQTLDTLELERERGITIKSTPIRL
TYRRANGEEYTFNLIDTPGHVDFGYEVSRSLAACEGVLLLVDASQGVEAQTIVNAYLAID
NNLEIIPVVNKIDLPAADPEGAAQELEEVIGIPAEEAVFASGKTGQGVDQILEAIVERIP
PPPGDPQAPLKALIFDSFYDAYQGVILFVRVLEGTLKPKQKIMLFSNGKSFEVDKVGTFS
PGLVVGDALSAGAVGWVAASIKDIHDAQVGDTITEKDRPTAEPFPGFKPAQPVVFSGLYP
TDTEDYRKLREALEKLKLNDAAFTFEPETSEALGFGFRCGFLGLLHAEIVQERLEREFDL
DLIATAPAVVYRVTLTNGEVFETQNPAEFPTRDRIARVEEPYIKLSIMLPEEYVGPVMQL
LQERRGNMVTMNYVGKRVELIYEVPFAEILYDFHDRLKSISRGYASMDYEQIGYREGDLR
KVDILVNGEVVDALAVIVHEDKAYSLGRKIVDKMAEVIPRQLFPVPVQAAIGGKIIARAT
VKAYRKDVLAKCYGGDITRKKKLLEKQKKGRARMKQIGTVEVPQEAFLAVLSTEE
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgttaggaatttctccatcatcgcccacgtggaccacggcaagtccacgctcgcc
gaccgcattctggagcggctgggcgcgatgggcgagcgcgacaagcgcgaccagacgctc
gacacgctcgaactggagcgcgagcgcggcatcaccatcaagagcacgcccatccgcctg
acctaccgaagagcgaacggcgaggaatataccttcaacctgatcgacacgcccggccat
gtggacttcggctatgaggtctcgcgttcgctggcggcctgcgagggcgtgctgctgctg
gtggacgcctcgcagggcgtggaggcgcagaccattgtcaacgcctacctcgccatcgac
aacaacctggagattatccccgtcgtcaacaagattgacctccccgccgctgaccccgag
ggtgccgcacaggagctggaggaggtgatcggcattcctgccgaggaggccgtgtttgcc
tccggcaagactgggcagggcgtggatcaaatcctggaagcgatcgtggagcggatcccc
ccgcctcccggtgatccgcaagcacccctcaaggcgctgatcttcgactcgttttacgac
gcctaccagggcgtgattctctttgtccgtgtgctggagggaaccctcaagcccaagcag
aagatcatgctgttttccaacggcaagtccttcgaggtggacaaggtgggcacctttagt
ccgggtttggtcgtgggcgacgcgctgtcagcaggggcggtgggctgggtggccgcgagc
atcaaggacatccacgacgcgcaggtgggcgacacgatcacggaaaaggaccgccccacc
gccgagcctttccccggcttcaagcccgcgcagccggtggtctttagcggcctctacccc
accgacaccgaggattaccgcaagctgcgcgaagcactggagaagctgaaactgaacgac
gcggcctttacctttgagccggaaacgtcggaggcgctaggctttggctttcgctgcggc
ttcctgggcctgctgcacgccgagatcgtgcaagaacggctggaacgcgagttcgacctc
gacctgatcgcgactgcacccgccgtggtgtaccgcgtgaccctcacgaacggcgaggtg
ttcgagacgcaaaaccccgccgaattccccacccgcgaccgtatcgcccgggtggaggaa
ccctacatcaagctctcgatcatgctgcccgaggagtacgtggggccggtgatgcagctt
ctgcaggaacggcgcggcaacatggtcaccatgaactacgtgggcaagcgcgtggagctg
atctacgaggtgcccttcgcggaaatcctctacgacttccacgaccgcctgaagtccatc
agccgcggctacgccagcatggactacgagcagatcggctaccgcgagggtgacctgcgc
aaggtggacatcctggtgaatggcgaggtggtggatgccctggccgtcatcgtccatgag
gacaaggcgtactcgcttgggcgcaagatcgtggacaagatggcggaggtgattcctcgg
cagctgttcccggtgccggtccaggcggccatcggcggcaagatcatcgcccgcgcgacc
gtgaaggcgtaccgcaaggacgtgctggcaaagtgctatggcggcgacatcacccgcaag
aagaagctgctcgaaaagcagaaaaaaggccgcgcccgcatgaagcagatcggcacggta
gaggtgccgcaagaagccttcctggcggtgctgagcacggaggagtaa

DBGET integrated database retrieval system