KEGG   Deinococcus geothermalis: Dgeo_1854Help
Entry
Dgeo_1854         CDS       T00353                                 

Definition
(GenBank) ribosomal protein S14
  KO
K02954  small subunit ribosomal protein S14
Organism
dge  Deinococcus geothermalis
Pathway
dge03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dge00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dgeo_1854
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dge03011]
    Dgeo_1854
Ribosome [BR:dge03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Dgeo_1854
  Bacteria
    Dgeo_1854
  Archaea
    Dgeo_1854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S14
Motif
Other DBs
NCBI-ProteinID: ABF46149
UniProt: Q1IX85
Position
complement(1959134..1959319)
Genome map
AA seq 61 aa AA seqDB search
MANTSKVVKAARGHKFAVQNYNRCSRCGRARGYYRFFGMCRICIRELAHKGELPGVKKAS
W
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacacctctaaagttgtgaaggcggcgcgcggccacaagtttgccgtgcagaac
tacaaccgttgcagccgctgcggccgtgcccgcggatactaccgcttcttcgggatgtgc
cgcatctgcatccgcgaactggcgcacaagggcgaactgcccggtgtgaaaaaggccagc
tggtaa

DBGET integrated database retrieval system