KEGG   Deinococcus geothermalis: Dgeo_1976Help
Entry
Dgeo_1976         CDS       T00353                                 

Definition
(GenBank) 6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
dge  Deinococcus geothermalis
Pathway
dge00030  Pentose phosphate pathway
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
dge01130  Biosynthesis of antibiotics
dge01200  Carbon metabolism
Module
dge_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
dge_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dgeo_1976
Enzymes [BR:dge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     Dgeo_1976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-ProteinID: ABF46270
UniProt: Q1IWW4
Position
2078153..2078830
Genome map
AA seq 225 aa AA seqDB search
MKLRVFPTPEATAQAAAEAFAQAAREAVAARGAFRVALSGGSTPKLMYRALRKLPDVPWP
AVHVYFSDERSVGPDSPDSNYRLAHDELLTHVPIPAGQIHRMEGERRPLEEAARAYAALL
PERLDVVLLGMGEDGHTASLFPGTQALEATGRVAANWVPKLKTGRLTFTFPEINAASERW
LLVTGSGKAEVLRAVQAGEGDYPVARVREPVWFLDAAAAAQLKQP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccgcgtctttcccacgcccgaagccacggcgcaggcagccgcggaagccttt
gcgcaggcagcgcgggaagcggtggcggcacgcggggcctttcgggtggcgctgtcgggc
ggcagcacaccgaaactgatgtaccgtgcgctccgcaagctgccggacgtaccctggccc
gccgtccacgtttacttcagtgacgagcgcagtgtggggccagacagccccgacagcaat
taccggctcgcgcacgacgaactgctcacacacgtcccgattcccgcaggccagatccac
cggatggagggcgagcgccgcccgctggaggaagccgcgcgggcctatgccgctctgctc
cccgaacggctcgacgtggtgctgctgggcatgggcgaggacggccataccgccagcctg
tttcccggcacccaggcgctggaggcaacaggccgggtggccgccaactgggtaccgaaa
ctgaagaccggacggctcaccttcacctttcccgagatcaacgcggcgagcgagcgctgg
ctgctggtcaccgggtcgggcaaggccgaggtgctgcgtgcggtgcaggccggcgagggg
gactatccggtggcgcgggtgcgggagccggtgtggttcctggacgcagcggcggcagca
caactgaagcagccctag

DBGET integrated database retrieval system