KEGG   Deinococcus geothermalis: Dgeo_2341Help
Entry
Dgeo_2341         CDS       T00353                                 

Definition
(GenBank) Dihydrolipoamide acyltransferase, (E2) component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dge  Deinococcus geothermalis
Pathway
dge00010  Glycolysis / Gluconeogenesis
dge00020  Citrate cycle (TCA cycle)
dge00620  Pyruvate metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
dge01130  Biosynthesis of antibiotics
dge01200  Carbon metabolism
Module
dge_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgeo_2341
   00020 Citrate cycle (TCA cycle)
    Dgeo_2341
   00620 Pyruvate metabolism
    Dgeo_2341
Enzymes [BR:dge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dgeo_2341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ABF46633
UniProt: Q1IVV1
Position
2460963..2462513
Genome map
AA seq 516 aa AA seqDB search
MKEVLLPELAESVVEGEILKWLVQEGETVALEQPLCEVMTDKVTVELPSPYAGVLQKRLA
QEGDVVAVHAPIALIAEAGEASGRKGESTPEAAASTAPSAIQAIQETAENPATTGAQLPP
QAAEEREQVGGSIVEAGHVAAKSDDDASLFKAFASEEPVRVQGLGSQRSGVATLTRPAPT
SAAARQEGRVLAVPAARQLARELGVDLAQVPGSGPNGRVRVQDVTAYLQQQDGRAANVPA
PAAQAPLTPVPQSATTPAATTRGTGGMPVPPVQYRTPKGYEHLEDRVPLRGMRRAISNQM
QASHLYTVRTLTVDEVNLSKLVAFRSRVKDEAQAAGVKLSYLPFIFKAVAVALRKYPSLN
SSFDEATGEIVLKRYFNIGMAVATDAGLTVPVLRDMNRKSIFELAREVSDLAARAQAGKL
TPDELAGSTFSVTNIGSIGALFSFPIINVPDAAILGVHSIQKRPIVNERDEIVAAHMMYL
SLSFDHRLVDGAEAARFCKEVIRLLENPDRLMLEAM
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtgctgctgcccgagcttgccgaaagcgtcgttgagggcgaaatcctgaag
tggctggtacaggagggcgagacggtcgccctggaacagccgctctgtgaagtgatgacc
gacaaggtcaccgtcgaactccccagcccctatgccggagtgctgcaaaagcggctggca
caggaaggggacgtggtggctgtgcatgcgcccattgccctgattgccgaagcgggcgag
gccagcggccggaaaggggagagcacgccggaagcagcggccagcacggctcccagcgcc
attcaggccatccaggagacggccgagaacccagccactacgggcgctcaactgcccccc
caagctgccgaggaacgtgagcaggttgggggcagcatcgtggaggccggacacgtggcg
gccaagagcgacgatgacgccagcctcttcaaggcctttgcctccgaagagccggtgagg
gtgcaggggctgggcagccagaggagcggcgtggctaccctgacccgaccggcacccacg
agcgccgcagcccgccaggagggccgtgtgctggcagtcccagctgcgcgccagctcgcc
cgcgaactcggggtggatcttgcacaggtgccgggcagtggccccaatgggcgggtccga
gtgcaggatgtgacggcttatctccaacagcaggacggtagggcggcaaatgttccagct
ccggcagcccaggcaccactcacgcccgtgcctcaatcggcaaccaccccggcagcaacc
acacggggcaccggtggaatgccggttccccccgtgcagtaccgtacccccaagggctat
gagcatctggaagaccgggtgcccctgcgcgggatgcgccgcgcgatctcgaaccagatg
caggccagccacctctacaccgtccgcaccctgaccgtggatgaggtgaatctgtccaaa
ctcgtggctttccgcagccgcgtcaaggatgaagctcaggcagcgggcgtaaaactcagc
tacctgcccttcatcttcaaggcggtggcagttgccctgcgcaagtaccccagcctgaat
tcctccttcgacgaggcgacaggcgagatcgtgctgaagcgctacttcaatatcggcatg
gcggttgccaccgatgcaggcctgaccgtgccggtgctgcgcgacatgaaccgcaagagc
atcttcgagctggcgcgggaggtaagtgacctggccgcccgcgcgcaggctggtaagctc
acgcccgacgaactcgcgggcagtaccttctccgtcaccaacattggctcgatcggggcg
ctgttctccttccccatcatcaacgtgccggacgccgcgatcctgggggtgcactccatt
cagaaacggcctattgtgaatgaacgggatgagatcgtcgcggcacacatgatgtacctc
tcgctcagctttgaccaccgtctggtggacggtgccgaggcggcgcgcttctgcaaggaa
gtgatccgtctgctcgaaaaccctgaccgcctgatgttggaagcgatgtag

DBGET integrated database retrieval system