KEGG   Deinococcus geothermalis: Dgeo_2349Help
Entry
Dgeo_2349         CDS       T00353                                 

Definition
(GenBank) cobyrinic acid a,c-diamide synthase
  KO
K02224  cobyrinic acid a,c-diamide synthase [EC:6.3.5.9 6.3.5.11]
Organism
dge  Deinococcus geothermalis
Pathway
dge00860  Porphyrin and chlorophyll metabolism
dge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dge00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dgeo_2349
Enzymes [BR:dge01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.9  hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing)
     Dgeo_2349
    6.3.5.11  cobyrinate a,c-diamide synthase
     Dgeo_2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB MipZ Fer4_NifH AAA_16
Motif
Other DBs
NCBI-ProteinID: ABF43784
UniProt: Q1J3Z4
Position
pDGEO01:144094..145419
Genome map
AA seq 441 aa AA seqDB search
MNRLVLAAPHSGSGKTTVASLLCLALRQRGLRVAPFKLGPDYLDPTHLTRAAGQPARNLD
SFLLTPERLRELFVRAAAQADISVLEGVMGLYDGRDPASDAHSTAELARLLQAPVVLVID
AGGSARTVAAVAHGLRSFGPDLNVVGVILNRVAGERHASLCEVALAQIGLPVLGFVPRDE
ALHLPARHLGLLSAEQASWNEAEALKAAAHLRLDTLLAAAQAPPLPLPAPAPRRPARRVR
IAYALDEAFHFYYPDALDALQEAGAELLPFSPLRDAGLPPDVGGVLLGGGYPEAHADELS
ANTAMRAALRSFAASGRPVIGECGGLMYLGETLEDTAGRLFEMCGVIPYRTRMAPRLTLG
YRDATVLTDSPLAPAGTLLRGHEFHHSVLTHAPTHPAYAWTDSGGRRVEEGYARGHVLAS
YLHLHWGASAQLAERLVEACS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgtctcgtcctcgccgcgccgcactcggggagcggcaagaccaccgtggcgtcc
ctgctctgcctcgcgctgcggcagcgtggccttcgtgtggcccccttcaagttggggccg
gactacctcgaccccacccacctcacgcgcgcggcggggcaacccgcgcgcaacctcgac
tcgttcctgctcaccccggagcggctgcgcgagctgtttgtgcgtgccgctgcccaggcc
gacatcagcgtgctagaaggcgtgatgggcctgtacgacggccgcgaccccgccagcgac
gcccattccaccgccgagctcgctcgcttgctccaggccccggtggtgctggtgatcgac
gcgggcggcagcgcgcggacggtggcggcggtcgcgcacggcctgcgttcctttggtcca
gacctgaacgtcgtgggcgtcatcctcaaccgggtggcgggcgagcggcacgcctcactt
tgcgaggtggcgctcgcccagattgggctgccggtgctgggctttgttccccgcgacgag
gccctgcaccttcccgcccggcacctgggcctgctgagcgccgagcaggcgagctggaac
gaggcggaggcgctcaaggccgccgcgcatctgcgcctggacaccctgctggccgctgcc
caggctccgccgctgcccctcccggctccggctccgcgccgccctgcgcgccgcgttcgc
atcgcctacgccctcgacgaggcctttcacttctactatcccgacgcgctcgatgcccta
caagaggcgggcgcggaactcctgccctttagtccgctgcgcgacgcgggcttgccgccg
gacgtggggggggtactgttggggggcggctatcccgaagcgcatgcggatgaactcagc
gccaacacagcgatgcgggcagccctgcggtcctttgcagcgtccgggcgtcccgtgatc
ggggaatgcggcggcctgatgtacctgggggagacgctggaggacaccgcaggccgcctc
tttgagatgtgcggcgtgatcccctaccgcacgcggatggccccccgcctcacgctcggc
taccgcgacgccaccgtgctcaccgactcgccgctggccccggcggggacgctgctgcgc
ggtcacgagttccaccacagcgtgctcacccacgcgcccacgcacccggcctatgcctgg
acggactccgggggccggcgggtagaggagggctacgcgcgcggccacgtgcttgcgagt
tacctacacctgcattggggggcttcggcccaactcgccgagcggctggtggaggcgtgc
tcgtga

DBGET integrated database retrieval system