KEGG   Deinococcus geothermalis: Dgeo_2350Help
Entry
Dgeo_2350         CDS       T00353                                 

Definition
(GenBank) magnesium chelatase, ChlI subunit
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
dge  Deinococcus geothermalis
Pathway
dge00860  Porphyrin and chlorophyll metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dgeo_2350
Enzymes [BR:dge01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Dgeo_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase AAA_5 MCM VWA Sigma54_activat VWA_CoxE
Motif
Other DBs
NCBI-ProteinID: ABF43785
UniProt: Q1J3Z3
Position
pDGEO01:142397..144097
Genome map
AA seq 566 aa AA seqDB search
MIPLYPLSAVAHQPDLRLALSLLAVSPDIGGVLIRGDRGAAKSTAARGLAALLPAAPDGT
PAPFVSLPLGATEDRVVGTLDLEAALRGEVRLQPGLLAQADGGVLYIDEVNLLADHLVDV
LLDVAAMGVNRVQRDGLSAEHPARLALVGSMNPEEGSLRPQFLDRFGLCVEVQAPTAAAE
RAEIVRRRMAFEADPAAFLATWRAEEEALAARLAAARERLPRVRVPDALLDTIATLSAEA
GVRSLRADLVLYRAARALAALEGREEVQHEDLSRVAPLVLAHRRDPHLPPPPPTSPPAAP
PPEQPPDHGAGPQDTPEDILAPTPPAAPLPLSPLAAVGSRRGGAGGPGRVVSSVPDPHPA
ALAVPATLRAALTRVATGAGPAALTRGDFHAPVREEVAGRRVLFVADASGSMGTRERMGA
VKGAMLAVLSEQGRRDRVALITFRGAGATLALDFTTDAAAAEAAITAAPTGGRTPLAHAL
RLAADVLAGEPQAQLVLLTDGRANVPLTPGGDAWAEALQMARALRQALRGAPALVVDTET
GHVRLGRAAQLAQALGAAVTTLGGPQ
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgctgtaccccctctccgcggttgcccatcagccggacctgcgcctggccctg
tcgttgctcgccgtctcgcccgacatcggcggtgttctgattcgtggggaccggggcgcg
gccaaaagcaccgcagcccgcggtctggccgccctgctccccgccgcaccggacggcacg
cccgctcccttcgtgagcctgcccctgggggcgaccgaagaccgtgtggtgggcaccctc
gacctcgaggcggcgctgcgcggcgaggtgcgcctccagccgggcctgttggcccaggct
gacggcggcgtcttgtatatcgacgaggtgaacctgctggccgaccatctggtggacgtg
ctgctcgacgtggccgccatgggggtcaaccgggtgcagcgcgacggcctgagcgccgag
catcccgcccgcctcgccctggtgggcagcatgaacccggaagagggcagcctacgcccg
caattcctggaccgcttcggcctgtgcgtggaggtgcaggcaccgaccgcggccgccgaa
cgtgccgagatcgtccgccgccgcatggcctttgaggcggatcccgccgcctttctggcc
acctggcgggccgaggaggaggccctggccgcccgcctcgccgccgcccgcgaacggctg
ccgcgcgtgcgtgtgcccgatgcgctgctggacaccatcgccaccctgagcgccgaggcg
ggggtgcggagcctgcgggccgacctggtgctgtaccgggcggcccgcgccctggctgct
ctggaagggcgcgaggaggtccagcacgaggacctctcccgagttgctccccttgtcctg
gcgcaccgccgtgacccccacctgccgccccccccgcccacgtcgccacccgccgcgccg
cctcccgaacagcccccggaccacggcgctggcccgcaggacacccccgaggacatcctc
gcgccgaccccgcccgccgcgcccttgcccttgtcaccgcttgccgctgtgggttcccgc
cggggaggagcgggtgggccaggccgcgtggtgagcagtgtgcctgatccccaccctgca
gccctggcggtgccggccaccctgcgcgcggccctgactcgcgttgcgacgggggcaggc
ccggcggccctgacccgcggggatttccatgcccccgtgcgcgaggaggtcgcgggccgc
cgcgtgctcttcgttgcggacgcgagcggcagcatgggcacccgcgaacgcatgggggcg
gtcaagggcgcgatgctggcggtgttgagcgaacaggggcggcgcgaccgcgtggcgctg
atcacctttcggggtgcgggggcgaccctggcgttggacttcacgacggacgccgccgct
gccgaggcggccatcaccgccgcgcccaccgggggccgcacgcccctcgcgcacgcgttg
aggctggccgccgacgtgctggccggcgagccgcaggcccagctcgtcctcttgaccgat
ggtcgcgccaatgtgcccctcacgcccggcggcgacgcttgggccgaggccctccagatg
gcccgcgccctgcgtcaggccctgcggggcgcgcccgccttggttgtggatacagagacc
ggtcatgtgcgcctgggccgcgcggcgcagctggcccaggctctgggcgccgcagtgacc
accctgggaggcccgcagtga

DBGET integrated database retrieval system