KEGG   Deinococcus geothermalis: Dgeo_2396Help
Entry
Dgeo_2396         CDS       T00353                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dge  Deinococcus geothermalis
Pathway
dge00010  Glycolysis / Gluconeogenesis
dge00620  Pyruvate metabolism
dge00640  Propanoate metabolism
dge00680  Methane metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
dge01130  Biosynthesis of antibiotics
dge01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgeo_2396
   00620 Pyruvate metabolism
    Dgeo_2396
   00640 Propanoate metabolism
    Dgeo_2396
  Energy metabolism
   00680 Methane metabolism
    Dgeo_2396
Enzymes [BR:dge01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dgeo_2396
Lipid biosynthesis proteins [BR:dge01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dgeo_2396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABF43830
UniProt: Q1J3V4
Position
pDGEO01:91961..93631
Genome map
AA seq 556 aa AA seqDB search
MTDVSGTDAAAYREALDFLLAHREDYAGAVRDFRWPELSEFNWALDHFSPLARELGGAPA
LVWDGGQVGYAELDAWSSRAANFLRKCGVRRGDRVLLMLSNVPELWAAFLACMKLGAVVI
PATTLLTPDDLRDRFERGGARCAVVEAAETPKFTDLVGFERISVGPVEGWTDFARAQDEP
AEFEPDGVTRASDPLLLYFTSGTTSRPKLVLHTHASYPAGHLSTLYWIGLRRGDVHWNVS
SPGWAKHAWSSFFAPLTVGAAVVLFNERFDARRVLELLERLNVTTLCAPPTVYRMLIQQD
LAGARVGLREVVGAGEPLNPEVIEVVRRAWGLTIRDGYGQTETTAQVGNTPGQPVKPGSM
GRPLPGYRVVLLDAAGREADEGELCLDLSARPLGLMAGYAGDEAKTRAVLGGAYYPTGDV
ARRDEDGYLWYVGRADDVFKSSDYRISPFELESLLIEHPLVAEAAVVPSPHPERLSVPKA
YVVLVAGAQPSRETALDILRFTRERLAPYKRVRRLAFRELPKTISGKIRRVELRAHAAEP
GRAELEFWEEDFEELR
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgtttcggggacggacgcggcggcataccgtgaggcgctggacttcctgctc
gcgcaccgcgaggactacgcgggggcagtgcgggattttcgctggcccgagctgtccgag
ttcaactgggcgctcgatcacttcagcccgctggctcgcgagctgggcggcgcccccgcc
ctggtgtgggacggcgggcaggtgggatacgccgaactggacgcctggtcgagccgcgcg
gccaactttctgcgaaagtgcggcgtgcggcgtggggaccgggtgttgctgatgctctcg
aacgtgccggagctgtgggcagcgttcctggcctgtatgaagttgggcgcggtggtgatt
cccgcgacgacgctcctcacgcccgacgacctgcgcgaccgttttgagcggggcggcgcg
cgctgcgcggtggtggaggcggcggagacgcccaagttcacggaccttgtgggcttcgag
cgcatcagtgtcggcccggtggagggctggaccgactttgcgcgcgcgcaggacgaaccg
gcggagttcgagccggacggcgtgacccgggcctccgatccccttttgctgtacttcacc
agcggcacgaccagccgccccaaactggtgctgcacacgcacgcgagctatccggccggg
cacctcagcacgctgtactggatcggattgcggcgcggggatgtgcattggaacgtgagt
tcgcccggctgggccaagcacgcctggagcagcttctttgcgccgctgacggtgggcgcg
gcggtcgtgctgtttaacgaacgcttcgatgcccgccgggtgctggaactgctggaacgc
ctgaacgtcacaaccctgtgcgcgccacccaccgtgtaccgcatgctgattcagcaggac
ctcgcgggcgcgcgggtggggttgcgcgaggtggtgggtgcgggtgagccgcttaatccc
gaggtgatcgaggtggtgcgccgcgcctggggccttaccatccgcgacggctacgggcag
accgagacgaccgcgcaggtcgggaacacgcccggtcagccggtgaagcccggcagcatg
ggccgccccctgccgggttaccgcgtggtgttgctggatgcggcgggccgcgaggcagac
gagggcgaactctgcctggacctctccgcccgcccgctgggcctgatggccgggtacgcg
ggcgatgaggcgaagacccgtgccgtgctgggcggggcctactaccccaccggcgacgtg
gcccgccgggacgaggacgggtacctctggtacgtgggccgcgccgacgatgtcttcaag
agcagcgactaccgcatcagtccctttgagctggaaagcctgctgatcgagcacccgctg
gtggccgaggcggcggtggtgcccagcccccatcccgagcggctgagcgtgcccaaggcg
tacgtggtgctggtcgcgggcgcacagccttcccgggagacggcgctcgacatcctgcgc
tttacccgcgagcggctggctccctacaagcgtgtgcggcgcctggccttccgcgagctg
cccaagaccatcagcggcaagattcgccgggtggagttgcgtgcgcatgctgcggagccg
ggccgtgccgaactggagttctgggaagaagatttcgaggagttgcgctga

DBGET integrated database retrieval system