KEGG   Desulfovibrio gigas: DGI_1989Help
Entry
DGI_1989          CDS       T02851                                 

Definition
(GenBank) putative delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
dgg  Desulfovibrio gigas
Pathway
dgg00250  Alanine, aspartate and glutamate metabolism
dgg00330  Arginine and proline metabolism
dgg01100  Metabolic pathways
dgg01110  Biosynthesis of secondary metabolites
dgg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dgg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DGI_1989
   00330 Arginine and proline metabolism
    DGI_1989
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dgg03000]
    DGI_1989
Enzymes [BR:dgg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     DGI_1989
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     DGI_1989
Transcription factors [BR:dgg03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    DGI_1989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh PutA_N
Motif
Other DBs
NCBI-ProteinID: AGW13765
UniProt: T2GB03
Position
2096007..2098997
Genome map
AA seq 996 aa AA seqDB search
MDPRTLEPAVIARGKEFFASISGEAPSIFDKGWWTGKVMDWSMKHEDFKVKMFRFVDVIP
AIHDTDSLVRHIKEYFQDGCGELPPVMSAGLKGASLAGSLGLGLMAKGIRSNIEKMGRQF
IVGQDAKEAVSSIEKLRKDGFAFVIDSLGEATMSEEEADEHLEDHLKLLDALGAAQKKWK
PLGNAGNELDWGHAPKVNLAVKPTAFYSQATPRDFEGSVQGMLKRLLPMALKVKEIGGFL
CIDMEQLSVKDITIEAYKRLLLHPELKDYPHLGLVLQTYLRDTEADLDDLLAWARQHNRP
ISLRMVKGAYWDYETVVARQNGWEAPVWLQKPESDACYERCAWKILQHADICHLACASHN
IRTISAVMEMAKALGVDESRYEFQVLYGMAEPVRKGLKNVAGRVRLYCPYGDLIPGMAYL
VRRLLENTANESFLRQSFVDEASQEELLADPATKILPAPEPAEPAAACVRKPFDNEAMVD
FTVPESRQAFPAAIAMVRSRLGRTYPLWIDGKDVETPDTIATRNPARQDEVIGHVCQAGV
EEVEAAIAAARTQQKAWARLPASQRADCLRKAAGICRERIVELSAWQVLEVGKQWDQAYA
DVAEAIDFLDYYANEAERLAAPRTEASLPGESNRLAYRPKGLVAVIAPWNFPFAISVGMC
AAALVTGNAVLYKPSSLSSVVGYGLKEVFQAAGIPGGVFNYLPGRSSVMGDHLVGHKDIH
GIAFTGSMEVGLHIIKTAAVPAPGQAHVKRVIAEMGGKNAIVIDDDAELDEAVAGTLYSA
FGFQGQKCSACSRVIVLDGVCDRFVPRLVAAARSVKIGPAEDSSNVMGPVIDPKQQRNVN
QYVELAHTEGNVLLMHTAPQPLWAEGCYVPLTIVEGITPQHRLAQEEIFGPVLSVMRAKD
FDQAMDWANSTQFALTAGLYSRSPARIERFKQEMEAGNLYINRGTTGALVHRQPFGGFKL
SGVGSKAGGPDYLLQFVDPVNTTENTMRRGFAPVDE
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atggatcctcgcaccctcgaacccgccgtcattgcccgcggcaaggaatttttcgccagc
atcagcggcgaggccccatccattttcgataagggctggtggaccggcaaggtcatggac
tggtccatgaagcacgaagacttcaaggtgaagatgttccgctttgtggacgtcatcccg
gccatccacgacaccgattccctggtccgccacatcaaggaatacttccaggacggctgc
ggcgagctgccgccggtgatgtctgccggcctcaagggggccagtctggccgggtccctc
ggcctggggctgatggccaagggcatccgttccaacatcgagaagatgggccgccagttc
atcgtggggcaggacgccaaggaggccgtgagctccattgaaaagctgcgcaaggacggc
ttcgcctttgtcatcgacagcctgggcgaagcgaccatgagcgaggaggaggccgacgag
catctggaagatcacctcaagctcctggatgccctgggcgcggcgcagaaaaagtggaag
cccctgggcaacgccggcaacgagctggactggggccacgcccccaaggtgaacctggcc
gtcaagcccacggccttctattcccaggccaccccgcgggactttgaaggctccgtgcag
ggcatgctcaagcgcctgttgcccatggccctgaaggtcaaggagatcggcgggttcttg
tgcatcgacatggagcagctcagcgtcaaggacatcaccatcgaggcctacaagcgcctg
ctgctgcatcccgaactcaaggactatccgcacctgggtctggtgctccagacctacctg
cgcgataccgaagccgacctggacgatctgctggcctgggcccggcagcacaaccggccc
atctccctgcgcatggtcaagggcgcgtactgggactacgagaccgtcgtggcccggcag
aatggctgggaagcaccagtctggctgcagaagcccgagtccgacgcctgctacgaacgc
tgtgcctggaagatcctccagcatgcggacatctgccacctggcctgcgcctcccacaac
atccgcaccatcagcgcggtgatggagatggccaaggccctgggcgtggatgagtcccgc
tacgaattccaggtgctctatggcatggccgaacccgtgcgcaagggcctgaagaacgtg
gccggccgcgtgcggctgtattgcccgtatggcgatctcatccccggcatggcctatctt
gtgcgtcgcctgctggaaaacacggccaacgagagctttttgcggcagagctttgtggac
gaagccagccaggaagaattgctggcagacccggccaccaagattttgcctgcgccggaa
cctgccgaacccgctgcggcctgcgtcaggaaaccgttcgacaacgaagccatggtggac
ttcaccgtgccggaaagccggcaggccttcccggcggccatcgccatggtccgcagccgg
ctggggcggacgtacccgctgtggatcgatggcaaggacgtggaaacgccggacaccatc
gccacccgcaacccggccagacaggacgaggtgatcggccatgtctgccaggccggcgtg
gaagaggtggaagcggccatcgccgccgcccggacgcagcagaaggcctgggcccggctg
ccggcgtcccagcgtgcggactgcctgcgcaaggcggcgggcatttgccgcgagcgcatc
gttgaactgagcgcctggcaggtgctggaagtgggcaagcagtgggaccaggcctatgcg
gacgtggccgaagccatcgacttcctggactattacgccaacgaggccgagcggctggcc
gcgccgcgcaccgaggcctccctgcccggcgagtccaaccgtctggcgtatcgtcccaag
gggctggtggccgtcatcgccccctggaacttcccctttgccatctccgtgggcatgtgc
gccgcggcgctggtgacgggcaatgcggtgctgtacaagccgtccagcctgtcttcggtg
gtggggtacgggttgaaggaagtcttccaggccgcgggcattcccggcggcgtcttcaac
tacttgcccggccgcagctccgtgatgggcgatcatctggtgggccacaaggacatccac
ggcatcgccttcaccgggtccatggaagtggggttgcacatcatcaagacggctgccgtc
ccggctcccggtcaggcccatgtgaagcgggtgatcgccgaaatgggcggcaagaacgcc
attgtcatcgacgacgacgccgagctggacgaagccgtggccggcacgctgtattccgcc
ttcggcttccaggggcagaagtgctcggcgtgctcgcgggtcatcgtgctggatggcgtg
tgcgaccgctttgtgccccggctggtggcggcggcgcgatccgtcaagatcggtccggct
gaggactcgtccaatgtcatggggccggtcatcgatcccaaacagcagcgcaacgtcaac
cagtacgtggaactggcccacaccgaaggcaacgtgctgctcatgcacaccgcgccgcag
cccctgtgggctgaggggtgctacgtgcccctgaccatcgtggagggcatcacgccgcag
catcgtctggcccaggaggaaatcttcggcccggtgctgtccgtcatgcgggccaaggat
tttgaccaggccatggactgggccaacagcacacagtttgcccttacggccgggctgtat
tcccgctctccggcgcgcatcgagcgcttcaagcaggagatggaagccggcaacctgtac
atcaaccgcggtaccaccggcgcgctggtgcatcgccagcccttcggcgggttcaagctc
tccggcgtgggctccaaggccggcggcccggactacctgctgcagttcgtggatcccgtg
aacaccaccgaaaacaccatgcgccgcggctttgccccggtggacgaatag

DBGET integrated database retrieval system