KEGG   Desulfallas gibsoniae: Desgi_0002Help
Entry
Desgi_0002        CDS       T02657                                 

Definition
(GenBank) chromosomal replication initiator protein DnaA
  KO
K02313  chromosomal replication initiator protein
Organism
dgi  Desulfallas gibsoniae
Pathway
dgi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dgi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Desgi_0002
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dgi03032]
    Desgi_0002
   03036 Chromosome and associated proteins [BR:dgi03036]
    Desgi_0002
DNA replication proteins [BR:dgi03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Desgi_0002
Chromosome and associated proteins [BR:dgi03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Desgi_0002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA AFG1_ATPase AAA_22 ATPase_2 AAA_16 RNA_helicase AAA_19
Motif
Other DBs
NCBI-ProteinID: AGK99630
UniProt: R4KJ21
Position
552..1889
Genome map
AA seq 445 aa AA seqDB search
MSSNNINSIWKKTISKIKNKLTPQSYSTWINTMQPIAIKNNIFYIGVPDQFSKDWLNNNY
ALLFSEIISDITNDKTTVQFILEDEMHQSNTNSGLTEELSDLKYSILNPRYNFENYVVGN
NNRFAHAACLAVAESPAKGYNPLFIYGGVGLGKTHLMHAIGHYARQHNSNDYIVAYVTSE
KFTNDLISAIREEKTVEFKNKYRSIDILLIDDIQFLAGKEATQEEFFHTFNTLYEANKQI
IISSDRPPKEIPTLEDRLRSRFEWGLITDIQPPDYETRIAILQKKAKLENLTVSDEVITF
IADRIHSNIRELEGALIRVTAYNSLNNEIIDKDKAAEILKDMLPDKKPVEITIELIQQKV
AGHFNIKLDDLKSKKRTRAIAYPRQIAMYLCRELTTESLPQIGNKFGGKDHTTVLHAHDK
IAAEVANDTTLSQSIKNLIDNIKQN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
ttgagctctaataatataaattctatatggaagaaaaccatcagcaaaattaaaaataaa
ttaaccccccagtcttattcaacatggataaatacgatgcaacctattgccattaaaaac
aatattttttatattggggtacctgaccaattttcaaaggactggcttaataacaattac
gcactcctttttagcgaaataatttcagatataaccaatgataaaactacagtccaattt
atcctagaggatgagatgcaccaatcgaataccaacagcggacttactgaagaattaagc
gatttaaaatactccatccttaatccaagatataattttgaaaactatgtagtaggcaat
aataacagatttgcgcatgcagcttgcctggcagtagctgaatcaccagccaaaggttat
aatccactttttatttatggtggtgttgggctgggaaaaacacatttaatgcacgccata
ggtcactacgccaggcagcataacagtaatgactatattgttgcctatgttacctcagaa
aaattcactaacgatctcatttcagcaatacgtgaagaaaaaacagttgaatttaaaaat
aaataccgtagtattgacattttactcattgacgatattcaatttttagctggtaaggaa
gcaacacaggaggaattctttcatacattcaacactttatacgaagctaataagcaaatt
attatatccagtgaccgtcctcccaaagaaatacctactctagaggacaggcttcgctcc
cgttttgaatggggtctcattacagatatccaaccacctgactacgaaaccagaattgct
atactacaaaaaaaagcaaaacttgaaaaccttaccgtctctgacgaagtaataaccttt
attgctgatcgtattcattctaatatcagggaactagaaggtgctttaattagagtaacc
gcctataattcattaaataatgaaataatagataaggataaggctgcagaaatattgaaa
gatatgttaccagataaaaaaccagttgaaattaccattgagctaatccaacaaaaagta
gccggccattttaatattaagcttgatgacttgaaatcaaaaaagagaacccgggccatt
gcttatcccagacaaattgccatgtatttatgccgcgaattaaccacagaatcattacct
caaataggtaataaattcggtggaaaagatcatacaacagtactccatgctcatgataaa
atcgccgctgaagtagccaacgacaccaccctatcccaatcaattaaaaatttaattgat
aacattaaacagaattaa

DBGET integrated database retrieval system