KEGG   Desulfallas gibsoniae: Desgi_0455Help
Entry
Desgi_0455        CDS       T02657                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
dgi  Desulfallas gibsoniae
Pathway
dgi00220  Arginine biosynthesis
dgi01100  Metabolic pathways
dgi01110  Biosynthesis of secondary metabolites
dgi01130  Biosynthesis of antibiotics
dgi01230  Biosynthesis of amino acids
Module
dgi_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:dgi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Desgi_0455
Enzymes [BR:dgi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Desgi_0455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AGL00030
UniProt: R4KHQ8
Position
421614..422525
Genome map
AA seq 303 aa AA seqDB search
MLSLHDFTPQQIAFMLDFAAQLKRMQKQGEPHALLQGQTLGMIFQKSSTRTRVSFEVGMY
QLGGHALFLSSNDLQLGRGESIADSGRVLGRYLDGIMIRTFAQSDVEELAEYASVPVING
LTDLLHPCQILADLLTVQEHKGRLAGLKMAYVGDGNNICHSLLYGCAKTGLHISVASPEG
YLPREEIVAAARQDALETGASVTITTRPEEAVSGADVLVTDVWASMGQESEQQARMKVFA
PYQINDRLAALAAPDYIFLHCLPAHRGEEVAAEIIDGPHAVVFDEAENRLHAQKAVMALL
MGK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgctctctctgcatgatttcacccctcagcaaattgcctttatgcttgattttgctgcc
caactaaaacgaatgcaaaaacagggcgagccccatgcgctgctgcaggggcagacattg
ggcatgatttttcaaaagtcttccacccgcaccagggttagtttcgaggtgggtatgtac
caactgggtggacatgccctgttcttaagctcaaacgacctgcagttggggcggggggaa
agtattgccgactccgggcgggttttggggcgctaccttgacggcatcatgatccgcacc
tttgcccaaagcgatgtggaggagttggccgaatatgcgtccgtgcccgtaattaacggt
cttaccgacctgcttcatccctgccagatactggcggatttgctgacggtgcaggagcat
aagggtcgcctggccgggctgaaaatggcctatgtgggcgacggcaacaacatttgccac
tcgcttctatatggctgtgccaaaacaggccttcatatcagcgtggcttcaccggagggc
tacctgccccgggaggagatcgtggcggcggcccgtcaggacgccctggaaacgggcgca
tctgtcactataaccaccagacccgaggaggccgtgtcgggggccgatgtattggtcacc
gatgtctgggccagcatgggccaggagagtgaacagcaggccaggatgaaggtgtttgca
ccttaccagatcaatgaccggctggcggccttggcggcaccggattacatattcctgcat
tgtttgcccgctcaccggggtgaagaggtggccgctgaaataatcgacggcccccatgcg
gtggtgtttgatgaggccgaaaaccgtctgcatgcccagaaggccgtaatggcgctgctt
atgggtaaataa

DBGET integrated database retrieval system