KEGG   Desulfotomaculum gibsoniae: Desgi_0469Help
Entry
Desgi_0469        CDS       T02657                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dgi  Desulfotomaculum gibsoniae
Pathway
dgi00071  Fatty acid degradation
dgi00072  Synthesis and degradation of ketone bodies
dgi00280  Valine, leucine and isoleucine degradation
dgi00310  Lysine degradation
dgi00362  Benzoate degradation
dgi00380  Tryptophan metabolism
dgi00620  Pyruvate metabolism
dgi00630  Glyoxylate and dicarboxylate metabolism
dgi00640  Propanoate metabolism
dgi00650  Butanoate metabolism
dgi00720  Carbon fixation pathways in prokaryotes
dgi00900  Terpenoid backbone biosynthesis
dgi01100  Metabolic pathways
dgi01110  Biosynthesis of secondary metabolites
dgi01120  Microbial metabolism in diverse environments
dgi01130  Biosynthesis of antibiotics
dgi01200  Carbon metabolism
dgi01212  Fatty acid metabolism
dgi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desgi_0469
   00630 Glyoxylate and dicarboxylate metabolism
    Desgi_0469
   00640 Propanoate metabolism
    Desgi_0469
   00650 Butanoate metabolism
    Desgi_0469
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desgi_0469
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Desgi_0469
   00072 Synthesis and degradation of ketone bodies
    Desgi_0469
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Desgi_0469
   00310 Lysine degradation
    Desgi_0469
   00380 Tryptophan metabolism
    Desgi_0469
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desgi_0469
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desgi_0469
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Desgi_0469
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dgi04147]
    Desgi_0469
Enzymes [BR:dgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Desgi_0469
Exosome [BR:dgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desgi_0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III Ketoacyl-synt_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGL00041
UniProt: R4KK98
Position
439607..440785
Genome map
AA seq 392 aa AA seqDB search
MARKKNFKVAVVGAGMNKFGELFHQSYEDMIVEAYRACLKSVDKGIDENDIQAAWLGTVQ
GSLIRRELVSGSSLAEPLGLSIPVTRIENVCAAGSDAIRNAACAIMAGLYETVLVVGAEK
MRDVPSRASLVANRGIMSHLWWHPRGASAPMVFGQIGTAHMHAYGTTREHFAKVAVKNHH
NGTLNPHAFFRFEITVEKVLNAPMVSWPLGLLDCCPTTDGAAAVILTTPERARQYTDKPI
YLIGTGLGVDVANSHWRSTYTEWPANIQAARQAYEMAGITPQDISLAELHDCFTCTELVT
YEDLGFCEKGRGGKWIDNGGPMLDGEKPCNVSGGLKAKGHPVGATGVAQANEIFLQLRGE
AGKRQVSNARLGLTHNIGGAGQLSCVNIYSNE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgtaagaagaacttcaaagtagctgttgtaggtgctgggatgaacaaatttggc
gaattattccatcagagctatgaagatatgatagttgaagcctaccgggcatgtttaaaa
agcgttgataaggggattgacgaaaatgatatccaggctgcctggttgggtaccgtccag
ggaagcctgatccgccgcgagctggtatccgggtcatctttggccgaaccccttgggctt
tctataccggttaccagaattgagaacgtttgtgcagctggaagcgatgccattcgcaat
gcggcctgcgctataatggcggggctgtacgagacagtgctggttgtaggtgcggaaaaa
atgcgcgatgtaccttccagagccagcctggtggctaaccgggggattatgtcgcatcta
tggtggcatccccggggcgcctcagcaccaatggtctttggtcagatcggtactgctcac
atgcacgcctatggcactacaagggaacattttgccaaggtggcggtcaaaaaccatcac
aacggaacattaaacccccatgcatttttccggttcgaaattaccgtcgagaaggtttta
aacgctccaatggtatcctggccgctgggtttgttagactgctgtcctaccacagacggc
gcggcagcggttattttgaccactccggagcgtgcccgccagtatactgataagccaata
tacttgatcggtacaggattaggagtagatgtggccaattcacattggcgaagcacttat
acggaatggccggccaatatccaggccgcccggcaggcctatgaaatggccggtattaca
ccccaagacattagcctggcggaattacacgactgctttacctgtacagagctggttact
tacgaggacctcggtttttgcgaaaaaggccggggagggaagtggatagacaacggcggt
cccatgttggatggtgaaaagccatgcaacgttagtggcggtttaaaggccaaaggccac
cctgttggggcgaccggcgtagcccaggccaatgaaattttcttacagttaagaggtgaa
gcaggtaagcgccaggtgtcaaatgcccggttggggttgacccataatatcggtggggct
ggtcaactaagttgcgtgaatatttacagtaatgaataa

DBGET integrated database retrieval system