KEGG   Desulfallas gibsoniae: Desgi_1155Help
Entry
Desgi_1155        CDS       T02657                                 

Definition
(GenBank) Fe2+ transport system protein B
Organism
dgi  Desulfallas gibsoniae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FeoB_N MMR_HSR1 FeoB_Cyto GTP_EFTU Dynamin_N RsgA_GTPase SRPRB ABC_tran
Motif
Other DBs
NCBI-ProteinID: AGL00678
UniProt: R4KBV4
Position
complement(1184804..1185592)
Genome map
AA seq 262 aa AA seqDB search
MGLTYQSTGQLTTREIFNANTDNCDYVIALAGNPNTGKSTVFNALTGLRQHTGNWPGKTV
QRAEGTYIHKSRRYRLIDLPGTYSLLANSADEEVARDFICFARPDATIVVVDATCLERNL
NLALQVMEITDKVIVCVNLIDEARRKKIQLNTAKLSDRLGVPVVATAARSGEGLSRLMDL
VDDVAMGRILPKPQPVRYSKEVEEAIAQLEPRVRALVGEDINSRWLTLRLLDCDTRLVRT
IENYLNARETAAAVPLAQEGLA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggccttacctaccaatcaaccggacagttaaccacccgggagatatttaatgcaaat
acagataactgtgattacgtaatcgcgttagcgggtaatcccaatacgggtaaaagcact
gtgtttaatgctttaacgggtttacggcaacataccggcaactggccgggtaaaacggtt
cagcgggctgaaggcacttatatacacaaatcgcgccggtatagactaatcgacctgccg
ggcacctattcactgctggccaattcagccgacgaagaagtggctcgggatttcatctgt
tttgccaggcccgatgccaccattgtggtggtagacgccacctgcctggaacgcaacctg
aacctggccctgcaggtcatggaaatcaccgacaaggtaatcgtttgtgtaaatctaatt
gacgaggccaggcgcaaaaaaatacagctaaatactgccaaactaagcgatcggctgggg
gtacccgttgtcgccaccgccgccagaagtggtgaaggcttgtctcggttgatggatctg
gttgacgatgtggcaatgggacgcatactgccgaaaccgcagcctgtgcgctacagcaag
gaagtagaggaagccatcgcccagctggagccccgggttcgggccttagtaggcgaggat
atcaactcccgctggctgaccctacgcctgcttgactgtgataccaggctggtacggacc
atagaaaattatttaaacgccagggaaacagcagcggccgtgcccttggcacaggaggga
ttggcctga

DBGET integrated database retrieval system