KEGG   Desulfallas gibsoniae: Desgi_1888Help
Entry
Desgi_1888        CDS       T02657                                 

Definition
(GenBank) putative metal-dependent phosphoesterase, PHP family
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
dgi  Desulfallas gibsoniae
Brite
KEGG Orthology (KO) [BR:dgi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Desgi_1888
Enzymes [BR:dgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Desgi_1888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AGL01336
UniProt: R4KNX9
Position
1923232..1924062
Genome map
AA seq 276 aa AA seqDB search
MFADLHIHTTYSDGLSTPEEVVRMAAHTKLRALAITDHDTMEGTQSARLEAALHGIDIVD
GVELSTECDGLEVHILAYCIDPNNTYFQEHLNVFRNARLKRAQKIVAKLQHMGIDITFDQ
VLELAGSGSVGRPHIAQALMAGGKTSSITEAFEQYIGVGKPAYEPRLKYHPVEMVKLVRK
LGGVPVLAHPGISCGEDLINSLIDAGLQGLEVYHPKHSRHVEDYYLGLCRTYGLVATGGS
DFHGVGVTGHGRLGEARVPYAAVKQLWALATKNSKL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctgatttgcatatacatactacctactccgacggtttaagtactccggaggaa
gtagtgcgtatggctgcgcataccaaattgcgggctttggctataaccgatcacgatacc
atggagggtacccagtcggcaaggctggaggctgccttgcatggaattgacattgtagat
ggagtggaattaagtactgaatgcgatggcctggaagtacatatccttgcttattgtata
gatcccaacaatacctattttcaggaacacttgaatgtctttcgcaatgcccggctgaaa
agagctcaaaaaattgtggccaagttacagcatatggggattgatattacttttgatcag
gtacttgagctggccgggtccggttcagtgggcaggccgcatattgcccaggctttaatg
gctggtgggaaaaccagcagtattactgaggcctttgaacaatatattggtgtgggtaaa
ccagcttatgagcccagattaaaatatcacccggtggagatggttaagctggtcagaaag
ttgggcggtgtgcctgtactggctcacccgggcatatcctgcggtgaggacttaataaat
tccctgattgatgccgggttgcaggggctggaagtgtatcatcccaaacattcgcggcat
gtagaagattactatctggggctttgccgaacatacgggctggtagccaccggtggctct
gatttccacggtgtaggcgtaacagggcacgggcgtctgggggaggccagggtaccttat
gcggcggttaaacagttgtgggcgctggccacaaaaaatagtaagctttag

DBGET integrated database retrieval system