KEGG   Desulfotomaculum gibsoniae: Desgi_1965Help
Entry
Desgi_1965        CDS       T02657                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dgi  Desulfotomaculum gibsoniae
Pathway
dgi00071  Fatty acid degradation
dgi00072  Synthesis and degradation of ketone bodies
dgi00280  Valine, leucine and isoleucine degradation
dgi00310  Lysine degradation
dgi00362  Benzoate degradation
dgi00380  Tryptophan metabolism
dgi00620  Pyruvate metabolism
dgi00630  Glyoxylate and dicarboxylate metabolism
dgi00640  Propanoate metabolism
dgi00650  Butanoate metabolism
dgi00720  Carbon fixation pathways in prokaryotes
dgi00900  Terpenoid backbone biosynthesis
dgi01100  Metabolic pathways
dgi01110  Biosynthesis of secondary metabolites
dgi01120  Microbial metabolism in diverse environments
dgi01130  Biosynthesis of antibiotics
dgi01200  Carbon metabolism
dgi01212  Fatty acid metabolism
dgi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desgi_1965
   00630 Glyoxylate and dicarboxylate metabolism
    Desgi_1965
   00640 Propanoate metabolism
    Desgi_1965
   00650 Butanoate metabolism
    Desgi_1965
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desgi_1965
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Desgi_1965
   00072 Synthesis and degradation of ketone bodies
    Desgi_1965
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Desgi_1965
   00310 Lysine degradation
    Desgi_1965
   00380 Tryptophan metabolism
    Desgi_1965
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desgi_1965
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desgi_1965
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Desgi_1965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dgi04147]
    Desgi_1965
Enzymes [BR:dgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Desgi_1965
Exosome [BR:dgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desgi_1965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt Ketoacyl-synt_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGL01410
UniProt: R4KLH7
Position
2005506..2006660
Genome map
AA seq 384 aa AA seqDB search
MSKDVAIIGVGQSAFVRGYQGSIRELAFEAFREAMQDAGISKSDIDASIICSAPEYDSQR
SPSGIIAEYLGLNPQPTFAVETVCSSSTTGLRAGYAMVKSGLHDIIVVLGFQKMSEISSA
DSQERMGRGGDIMWESPFGSMMPAYYAMHACAHFDKYGSTEKDLAMIRVKAAKYGTINEK
AVYRKEVSLEDALNAPYVSSPLKRFDCCANADGASCIIIANKDRAKDICPKPVWFMGLGS
ATASMTLTNRDTLYGIACARKAAQEAYAMAGVTPQDIDVAEVHDCFTIAELLAYEALGFA
EPGKGVELIREGQTYIGGKIPVNVDGGLLSKGHPIGATGGSQVRTIVLQLRDEAGGMQVP
GAEIGLIHNIGGVGVYGNVIILGR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagatgtagctataattggcgtaggccaaagtgcatttgtgaggggctatcag
ggatcgataagagagttggcctttgaggcttttagagaagctatgcaagacgctggaata
agcaaaagtgacattgacgcatcaattatttgttctgcgccagaatatgacagccagcgt
agcccttcggggatcattgccgagtatctcgggctaaaccctcagcctacctttgcggta
gagacagtatgctcatccagtaccacaggactacgggcaggttatgcgatggttaaatcg
ggcctacatgatattatagtggttctgggttttcaaaaaatgtcggaaatctcttcagct
gattcccaagaacggatgggtcggggtggcgacattatgtgggaatcaccttttggctct
atgatgcccgcatattacgctatgcacgcctgcgctcattttgataaatacggcagcacg
gaaaaagatctggctatgattagggtaaaggctgccaagtacggcacgattaatgaaaag
gccgtgtaccgcaaggaggtcagcttggaggatgcattaaacgctccatatgtcagtagt
cccctcaagcgatttgactgctgtgccaatgctgacggtgcttcttgcataatcattgca
aacaaggacagagctaaggatatttgcccaaagccggtttggtttatgggtttgggttca
gctacggcatccatgacgcttacgaaccgtgacaccctttacggtatagcatgcgcccgc
aaggccgctcaagaggcttatgccatggcgggggtaacaccccaggatattgatgtggca
gaagttcatgattgttttaccatagctgaactgctggcttatgaagccctggggtttgcc
gagccgggtaagggagtcgagctgatccgtgaagggcaaacatatattggcggcaaaata
ccggtcaatgttgacggtggcttgctctccaagggacaccccatcggtgcaacgggtggc
tcgcaagtgcgcaccatcgtgttgcagttgcgtgatgaagctgggggcatgcaggttcca
ggggccgaaataggattgattcataatattggcggagtgggtgtttacggcaacgtgatc
atcctggggaggtag

DBGET integrated database retrieval system