KEGG   Desulfallas gibsoniae: Desgi_2333Help
Entry
Desgi_2333        CDS       T02657                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
dgi  Desulfallas gibsoniae
Pathway
dgi00010  Glycolysis / Gluconeogenesis
dgi00020  Citrate cycle (TCA cycle)
dgi00620  Pyruvate metabolism
dgi01100  Metabolic pathways
dgi01110  Biosynthesis of secondary metabolites
dgi01120  Microbial metabolism in diverse environments
dgi01130  Biosynthesis of antibiotics
dgi01200  Carbon metabolism
Module
dgi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desgi_2333
   00020 Citrate cycle (TCA cycle)
    Desgi_2333
   00620 Pyruvate metabolism
    Desgi_2333
Enzymes [BR:dgi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Desgi_2333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP PEPCK_GTP AAA_33
Motif
Other DBs
NCBI-ProteinID: AGL01750
UniProt: R4KMI5
Position
2356171..2357709
Genome map
AA seq 512 aa AA seqDB search
MNFSRRPVEAAKMIINPSHEELKILAQEGNKTTIYNSASFISSVRNRSAKKTYIVEDGVP
LGVDQQGISIAEANRIADEVHEYLKQQEVIRLDRRMGLHPDFSLHCRLFITTRFARIPLK
WNIMLFPSVEPEAEPDLLSIYVPEWPERVIFCHPLSYTTYILGTDYFGEAKKSFLRMAMF
RTKTEGGLGFHAGSKVLRIKLPGGELKDAGFLLFGLSGTGKTTLTMHDHNLTPPEQAIIR
QDDVVMMNPQGYCYGTENGFYIKTEGLDESQKVLYHAAQSPEAIFENVKVNDDGSIDFNN
TELTSNGRGVIRREDVLGVDSNIDLDKAHRMIFITRHDKMVPPVAKLNPHQAAAFFMLGE
SVETSAGDPTKAGQSKREVGTNPFIVGLEGEEGNRLLEILEANPDMECYLLNTGSIGMGG
NRPGVKISIHASTTILKYIATGEIKWQTDPDWGYQIPEHIPELDMTVYDPRSYYTKEEYL
SMVQQLREERIRWLDKYPELKLEIKNTIKQPK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttttcaaggagacctgtagaagccgccaaaatgattattaacccaagccatgaa
gagcttaaaattttggcccaagaaggtaacaaaaccactatttacaacagtgccagtttt
atatcctccgtgcgcaaccggagtgctaagaaaacctatattgttgaggacggggtgcca
ctgggcgtggaccagcagggtatctccattgccgaagcaaatcgcatcgctgacgaagta
catgagtatttaaaacagcaagaggtcatcaggctggaccgccgtatgggattacatccc
gattttagcctgcactgccgtctatttattactacaaggtttgcacgcattccgttaaaa
tggaatatcatgctcttcccatcagttgaacctgaagctgaacccgatttactcagtatt
tatgtgccagaatggcctgaaagagttatcttttgccatcccctctcctatacaacttac
atcctgggaaccgattatttcggtgaagctaaaaaatcttttctgcgcatggccatgttt
cgcacaaaaacagaaggcgggctcggttttcatgcaggcagcaaggtactgcggataaaa
ttaccgggtggtgagttaaaagatgccggtttcctccttttcggccttagtggaacagga
aaaactacgctgaccatgcatgaccataatttgactccaccggaacaggccatcatcaga
caagacgacgtggtaatgatgaatccccagggatactgctatggcacggaaaacggtttc
tatataaagaccgaaggtcttgatgagtcacaaaaggttttataccacgccgcacaaagc
cctgaggcaatttttgaaaacgtcaaggtaaatgacgacggctcaatcgactttaataat
actgaactcacctccaacggccggggcgttatccgcagggaggatgttttgggggttgac
agcaatatcgacctggataaagcccatcgcatgatcttcatcactcgtcatgacaaaatg
gtccctccggtggctaaattgaacccccaccaggcggctgcctttttcatgctgggtgaa
tcagtcgaaacctcggccggtgatcccaccaaagcagggcaatccaaacgggaagtgggc
accaatccgtttatcgtaggtttggagggggaagaaggaaaccggctgctggaaatcctg
gaggccaatcccgatatggaatgttacctgcttaacacaggcagcattggtatgggcggt
aaccggccgggggtgaaaatcagtatccatgcttccaccactattctaaaatatattgcc
accggggaaataaaatggcaaacagaccctgattggggctatcagatacctgagcatata
ccggaactggacatgaccgtttacgacccccggtcttactatactaaagaggaatatcta
tcaatggtacaacagcttagagaggaaaggatccgctggctggataaatacccggaatta
aaactcgaaattaaaaacaccatcaagcaaccgaaataa

DBGET integrated database retrieval system