KEGG   Desulfallas gibsoniae: Desgi_3592
Entry
Desgi_3592        CDS       T02657                                 

Definition
(GenBank) aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL-like protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
dgi  Desulfallas gibsoniae
Pathway
dgi00230  Purine metabolism
dgi01100  Metabolic pathways
dgi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dgi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Desgi_3592
Enzymes [BR:dgi01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Desgi_3592
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AGL02915
UniProt: R4KQQ0
Position
3599177..3601447
AA seq 756 aa
MKEYKVIGKSIRRLDAWEKSAGTGTFTTDIYLPGMLFGKVLRSPYPHARIKKIDTTKAEQ
LPGVEAVLCYKNSTRVIFNTSATMTTTVPPMKPVLDQYIFDNVVRYVGDEVAAVAAVNEK
IAVQALELIEVEYEPLSAVYDAKQAMTSDALEIHSDCPAGKNIPGEIIHLEMGNLEQGFN
ESDLIFEEEFKLPIVKQVQMETQAAVAQVSIDGSITVYSTTQTPHPSAQILAHIFQLPVS
KVRVLNPPYLGGGFGVRIGLSGKAEAIATELAMKTGKPVKVVYDRKEDFIASDTRHGGYV
TVKLGLKNDGVFHALELKANLNTGAYCSFGVEAAGVLGAMGLSVYRIPHQVYHGHSTYTN
CTPAGAMRGFGNPQAMFPIESVVDMAAERLGMDAKELRLKNIIKPGDKWVLPYPCKSSGL
PECIEKGAREIGWNNRGKLNKPGDKIRRGIGMGVGTHVSNSWPFCVDFSNALVTIKSDGT
IKVASGVVDMGTGTKTSLAQIAAETVGVYDMSKVSVTLADTESTPFEIGSHASRSCYTAG
QAVYLAAQDARSQVLEYAADYLKERMEYLDIKDGVIYSGNEARISLAELTEYAHLHNKQF
LGVGKVVPSNAPPWEAHFAEVEVDTETGQVRVIKLVAAHDVGKAIHPVIVEGQLEGGLVQ
GMGYALSEEIRYNDKGKQLHDGIHKYMLPTAEDIPEIKVILVEPHDPSGPYGAKGVGETS
LVPTAPAITNAIYDAIGIRFKEIPVTEEKVFKALYK
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgaaagaatacaaagttataggaaaaagcatccgccggcttgatgcctgggaaaaatca
gctggaacgggaacttttacgactgacatttacttgcctggcatgctgttcggtaaagtg
cttcggagtccatacccccatgccagaataaaaaaaattgatactaccaaagctgaacag
ttgccgggggtagaagccgttttatgctataaaaattctaccagggtaatattcaatact
tcagccaccatgacgacaactgttccgcccatgaaaccggttttggaccagtacattttt
gacaatgtagtgcggtatgtcggggacgaagtggctgcagtggctgctgtcaatgaaaaa
atagctgtccaagcccttgaattaatcgaagtggaatacgaaccactgtctgcagtgtac
gatgctaaacaagccatgacctcagacgctcttgagatccacagcgactgtccggccggt
aagaatataccgggagaaataattcacctggaaatgggcaatctggagcagggttttaat
gaaagtgatctgatttttgaagaagaatttaagctgcccattgttaaacaggttcaaatg
gaaactcaagcagccgtagcacaagtgtctattgacggcagtattaccgtttactccact
acccaaactccgcacccatccgcccaaatactggcacacatttttcaactgccggtaagc
aaagtgcgagtattaaatcctccatacctagggggcggtttcggagttcgtatcggcctt
agcggtaaggctgaagctattgcgacagaactggccatgaaaacaggaaaacccgtaaaa
gtagtttacgaccgcaaagaagactttatcgcctctgataccagacatggcggttacgtt
acagtaaaactggggttaaaaaatgacggcgttttccacgctttagaattaaaagcaaat
cttaacaccggagcgtattgcagctttggcgtagaggctgccggcgtacttggagcaatg
ggactctcagtttacagaatacctcatcaggtctaccacggccacagtacctacacaaac
tgcactccagccggagctatgcgcggtttcggcaacccccaggcaatgttccccatagaa
tccgtggttgacatggccgccgaacgtctgggtatggatgcaaaagaattacggcttaaa
aatataatcaagcccggagataaatgggtattgccttacccatgcaaaagcagcggatta
cccgaatgcattgaaaagggcgcccgggaaataggctggaataacagaggaaaactaaac
aagcccggagataaaatccgcagaggaataggtatgggtgtgggtacacacgtaagcaac
tcctggcccttctgtgttgatttctccaacgccctggtaaccataaagagcgatggaact
attaaggttgcatcaggtgtggtggatatgggaaccgggaccaaaacaagtcttgctcag
attgcagcggaaaccgttggtgtatatgatatgagcaaagtatcggtaacccttgcagac
accgaatcaacaccctttgaaatcggcagccacgccagtcgttcatgctacaccgccggg
caagctgtctatcttgccgcacaggatgctcgctcccaggtactggaatacgcagcagat
tatttaaaagagcgtatggaataccttgacattaaagatggggtgatttatagcggcaac
gaggcaagaatatccctggccgagttaactgaatacgctcacctgcataataaacagttt
ctaggagtaggcaaagttgttccgtccaacgcccccccgtgggaagcgcactttgctgaa
gtagaagtcgatactgaaacaggtcaagtccgggtaattaaactggtagcagcacacgac
gttgggaaggccatacatcctgttatcgtagaagggcaactggagggaggtctggtccag
ggtatggggtacgccctgagcgaagagattcgttataacgacaagggtaaacaattacat
gatggtatccataaatatatgcttcccaccgctgaagatattccggaaattaaggtaatt
cttgtagagccgcatgaccccagcggaccctacggcgcaaaaggagtgggtgaaaccagc
ctggtacccaccgccccggccattaccaatgccatttacgacgcaatcggtatccgcttt
aaggaaataccagtgactgaagaaaaagtttttaaagctttgtataagtga

DBGET integrated database retrieval system