KEGG   Desulfallas gibsoniae: Desgi_3691Help
Entry
Desgi_3691        CDS       T02657                                 

Definition
(GenBank) acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
dgi  Desulfallas gibsoniae
Pathway
dgi00061  Fatty acid biosynthesis
dgi00071  Fatty acid degradation
dgi01100  Metabolic pathways
dgi01212  Fatty acid metabolism
dgi02024  Quorum sensing
Module
dgi_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:dgi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Desgi_3691
   00071 Fatty acid degradation
    Desgi_3691
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Desgi_3691
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dgi01004]
    Desgi_3691
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dgi04147]
    Desgi_3691
Enzymes [BR:dgi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Desgi_3691
Lipid biosynthesis proteins [BR:dgi01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Desgi_3691
Exosome [BR:dgi04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Desgi_3691
  Exosomal proteins of breast cancer cells
   Desgi_3691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Med2
Motif
Other DBs
NCBI-ProteinID: AGL03013
UniProt: R4KIL3
Position
3693655..3695190
Genome map
AA seq 511 aa AA seqDB search
MNLPMRLAEIARVSPGQEAIVFKNQRMTYAQLDTRVSQLASGFQQLGIKTGDRVLLAMRN
CPEFVIAYYAIMRMKGIVVPVNPQYTINEMGVIIKDCMPTAVITCPERQELFDNIRQSIN
IPAGIIVNSCDSLNEDIKTFDQISDKSINAFQEVKYNREDVTEIMYIAGMTGKPKGVMLT
NYNLYSNALTFSQACSLSPADRALLTAQAYHAGPQTCVMNSTIISGGTLVIQEGWRGAEE
VLRAIDEEKITFFFGPPTMYSLMLKYPELDKYDTSSLRIALCGSASMPPDLYESLVSKLN
IYLTEGYGLTETSPVVTLNFINKSGKKGSIGKPIPGVEVKIFDYEDREVPQGQVGEIVVR
GPNVMKGFLNREEETRWALRNGWFHTGDLAYEDQDGYLYLVDRKKDLIIRGGININPHEV
EEVLYEHPGIFEVAVVGVPDAVMGEEVLAYIMPRENYELDELKMKEFCKDKISKYKIPRY
FRFVDNLPKTSSGKLMRKELKNWIAKQKPPV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcctatgaggcttgcagaaattgctcgggtttccccgggtcaagaggcaata
gtattcaaaaaccagaggatgacttacgctcagctagatacccgggtcagccaattggcc
agtggtttccagcaactgggcataaaaacaggtgaccgggtgctgctggctatgcgcaat
tgcccggaatttgtcattgcatactatgctattatgcgcatgaagggtattgtggtacca
gtcaatccccagtataccatcaatgaaatgggtgtaatcattaaggattgcatgcctacc
gccgttataacctgtccggaaaggcaggaattgtttgataatattagacaatccataaat
atacctgcgggtatcattgtaaatagctgcgattcacttaatgaagacataaaaacattc
gatcaaattagcgataaaagcattaatgcctttcaggaagtaaaatataatcgcgaagat
gtaactgaaatcatgtatattgccggaatgaccggcaaacccaagggagtaatgcttaca
aattacaatctttacagcaatgcactgacattctcccaggcttgttctttaagcccggcg
gatcgcgctcttttaacagcgcaagcttaccatgcgggaccacaaacctgtgtcatgaat
agtactattatttcaggaggtacccttgtaatacaggaaggttggagaggtgcggaagag
gtgctacgggctattgatgaagaaaaaattaccttctttttcggcccaccaacaatgtac
agcctgatgctcaagtacccggagttggacaaatatgataccagctcactgcgtatagcg
ctctgtggctctgccagcatgccaccggatctttatgaatccctggtatcaaagcttaat
atctatcttactgaaggttacggcttaactgaaacatccccagtggtaacactaaacttt
attaacaaatcagggaaaaaaggttctataggaaaacccataccaggcgtggaagtgaaa
atatttgattacgaagaccgggaggttccccaaggccaggtgggcgaaattgttgtacgt
ggtcccaacgtaatgaaagggtttttaaaccgggaagaagaaacccgctgggcactgcgt
aatggttggtttcacaccggagatctggcatatgaagatcaggatggctatctttaccta
gtagaccgaaaaaaggatcttatcatacgcggtggtataaatattaatccccacgaggtt
gaagaagtactatacgaacaccctggcatatttgaagttgccgtagtaggtgtgccggac
gcagtaatgggagaagaagtgctggcctatataatgcccagagaaaattacgaattagat
gagttgaaaatgaaagaattttgcaaggataaaatatcaaaatataaaatacctcgctat
tttcgttttgtagataatctgcccaaaacgtcatccggcaaattaatgcgtaaagagcta
aaaaactggattgctaaacaaaaacctccggtataa

DBGET integrated database retrieval system