KEGG   Desulfallas gibsoniae: Desgi_4138Help
Entry
Desgi_4138        CDS       T02657                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
dgi  Desulfallas gibsoniae
Pathway
dgi00780  Biotin metabolism
dgi01100  Metabolic pathways
Module
dgi_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:dgi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Desgi_4138
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dgi01007]
    Desgi_4138
Enzymes [BR:dgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Desgi_4138
Amino acid related enzymes [BR:dgi01007]
 Aminotransferase (transaminase)
  Class II
   Desgi_4138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1 SHMT
Motif
Other DBs
NCBI-ProteinID: AGL03393
UniProt: R4KJL7
Position
4214065..4215231
Genome map
AA seq 388 aa AA seqDB search
MEFIKEELTSLKQYGIYRDLKTMVESQAPRTMVNGKKCILLSSNNYLGLTEHPDLITAAR
NAISIWGTGAGGSRLISGNFRIHEELEETIAHFKNTESAIVFNSGYMANMGTITALAGKE
DIIFSDELNHASIIDGCRLSRAKTRIYPHKNTGVLEKLLQKSTGYRRRLIVTDGVFSMDG
DLAPLPRLVDLAEKYNAVLMVDDAHATGVLGRRGAGSAEHFGLEGKITIQMGTLSKAIGS
TGGYVAGSHDLINYLRNKARSFIFSTALPPSVIATGLEAFRVLQKYPRIRENLHNNAFYL
RTGLTQMGFTILSEESPIIPVLIGDANKTIQMAQLLFSLGVFTPGIRPPTVPPGTSRVRV
TVMATHTREELDTALHAFAQAGQTLGVI
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggaatttataaaagaggagttaaccagtctcaaacaatacggcatttaccgcgacctt
aaaacgatggtcgaatcccaggccccccgcacaatggttaacggcaaaaagtgcatctta
ttatcgtctaataattacctggggttaactgaacacccggatttaataacagccgccagg
aatgctataagtatttggggcacaggtgcggggggttcccgtttaatcagcggcaatttc
aggatccatgaagaactggaggaaaccattgcccactttaaaaatacagaatcagcaatt
gtctttaatagcggttacatggctaatatgggaacgataaccgcgctggccggaaaagag
gacatcatcttcagcgatgagttaaatcatgccagcatcattgacggctgccggcttagc
cgggcaaaaaccagaatatacccccataaaaacaccggtgtccttgaaaaattattacaa
aagtctaccggttaccgacggcgtcttatagtaactgacggggttttcagtatggacggc
gatctggccccgttaccccgtttagtagatttggcagaaaaatataacgctgtattaatg
gtagacgatgcccatgcgaccggagtattggggcgccggggtgccggatcggcggaacat
ttcggtttggaaggaaaaattactatccaaatgggtaccttaagcaaggcaatagggagc
acaggcggctatgtcgccggctcccatgatttaattaattaccttagaaataaagcacgt
agctttattttctccactgctcttcccccttctgtaatcgccactggattagaggctttt
agggttttacaaaaatacccccggattcgggaaaatctacataataacgctttctacctc
agaaccggattaacgcaaatgggctttacaattctatccgaagaatcacccataatacct
gtattaataggtgatgcaaataagacgatacaaatggcccaattacttttttccctgggc
gtatttaccccgggaattaggccgcccacagtgccgccaggtacgagtagagtaagggtt
acagtgatggccacgcacacccgggaagaattggacacggccttgcacgcctttgcgcag
gccggccaaacactgggcgttatctaa

DBGET integrated database retrieval system