KEGG   Deinococcus gobiensis: DGo_CA0855Help
Entry
DGo_CA0855        CDS       T01827                                 

Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00220  Arginine biosynthesis
dgo00330  Arginine and proline metabolism
dgo01100  Metabolic pathways
dgo01110  Biosynthesis of secondary metabolites
dgo01130  Biosynthesis of antibiotics
dgo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    DGo_CA0855
   00330 Arginine and proline metabolism
    DGo_CA0855
Enzymes [BR:dgo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     DGo_CA0855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFD24782
UniProt: H8GYC9
Position
complement(951597..952481)
Genome map
AA seq 294 aa AA seqDB search
MDLGAGRRGVDMGPSALRNAHLAARLRELGHAVSDLGDVDVALPETLDKHAHSGLAFLDP
ILDACRTTTQRLATLPADTFPLTLGGDHSVSMGTVAGGALRGGGGVGGQGARTGLIWVDA
HTDYNTPGSSPSGNIHGMPVAHLTGLGDERLAALGGDWHVRPEDVVMIGIRSVDAREREL
LRGAGIKAYTMKDVDQLGITRIHEEALERLAHTERLHVSFDADALDPAVCPGVGTPVPGG
LTYREGHLLMELLSESGRVTGMDIVEVNPVLDTRNQTAEIMVGMAASLLGQRIL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggacctcggggccgggcggcgcggcgtggacatgggcccgtcggccctgagaaacgcc
cacctcgccgcgcggctgcgggagctcgggcacgcggtcagcgacctgggcgacgtggac
gtggccctgcccgaaacgctggacaagcacgcccacagcgggctggccttcctggacccg
atcctggacgcctgccggacgaccacgcagcgtctcgccacgctgccggccgacaccttt
cccctgacgctggggggtgaccacagcgtcagcatgggcaccgtggcgggcggggccctg
cgcggcggcggtggagtgggcggtcagggcgcgcgcaccgggctgatctgggtagacgcc
cacaccgactacaacacgccgggcagcagtccgagcggcaatatccacggcatgccggtc
gcgcacctcaccgggctgggcgacgagcgcctggccgcactgggcggagactggcacgtg
cgccccgaggacgtggtcatgatcggtatccgcagcgtggacgcccgcgagcgcgaactg
ctgcggggggcgggcatcaaggcctacaccatgaaggacgtggaccagctcggcatcacc
cgcatccatgaagaggcgctggagcgcctggcccacaccgagcgcctgcatgtctccttc
gatgccgacgccctggacccggccgtatgccccggcgtgggcacccccgtccccgggggc
ctgacctaccgcgagggccacctgctcatggaactgctctcggagtcggggcgcgtgacc
ggcatggacatcgtggaggtcaacccggttctcgacacgcgcaaccagaccgccgagatc
atggtgggcatggccgccagcctgctgggccagcggattctctga

DBGET integrated database retrieval system