KEGG   Deinococcus gobiensis: DGo_CA2361Help
Entry
DGo_CA2361        CDS       T01827                                 

Definition
(GenBank) Delta-1-pyrroline-5-carboxylate dehydrogenase 2
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00250  Alanine, aspartate and glutamate metabolism
dgo00330  Arginine and proline metabolism
dgo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DGo_CA2361
   00330 Arginine and proline metabolism
    DGo_CA2361
Enzymes [BR:dgo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     DGo_CA2361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh ALF
Motif
Other DBs
NCBI-ProteinID: AFD26288
UniProt: H8GZX6
Position
complement(2508154..2509725)
Genome map
AA seq 523 aa AA seqDB search
MIKVQDYRPQSFIDFTQPENVKAYQDALKKVRAELVGKHYPVVIDGVAVETAEKIESRNP
CDTAELVGTTGKATTQDAQKALDGAWKAFESWKKWDMDARARVLLKAAAILKRRRLEACA
LMSIEVGKNYAEADVEVAEAIDFLEYYARSAMKYAGFGSSETTWFEGEENGLMSIPLGVG
VSISPWNFPCAIYLGMLAAPIVAGNCVIAKPAEDAGLIAGFVTEIMYEAGLPAGVLQFLP
GVGKEVGEFLTTHAKTRFVTFTGSRAVGLHINEVAAKVQPGQKWLKRVIMELGGKDAMIV
DETADLDVAITAAVQGAFGFNGQKCSAMSRLVVVDEVYDAVVNGFVERTRALKMGTGEEN
ANVTAVVNQMSFDKVKSYLDLAPQEGTVLLGGQAPGEYGGTSGYYVQPTIVGDVKRDARM
AQEEIFGPVVTVLRARDWQDALDIANSTEYGLTGGVCSRSRERLEQARAEFEVGNLYFNR
KITGAIVGVQPFGGYNMSGTDSKAGGPDYLANFMQLKTVTERW
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagttcaggactaccgcccgcagagcttcatcgactttacgcagcccgagaac
gtcaaggcgtatcaggacgccctgaagaaggtccgcgccgaactggtcggcaagcactac
ccggtcgtcatcgacggcgtggcggtcgaaacggcagaaaagatcgaaagccgcaacccc
tgcgacaccgccgaactcgtgggcacgaccggcaaggcgaccacccaggacgcccagaag
gccctcgacggtgcctggaaggctttcgagagctggaagaagtgggacatggacgcccgc
gcccgcgtgctgctcaaggccgccgcgatcctgaagcgccgccgcctggaagcctgcgcc
ctgatgagcatcgaggtgggcaagaactacgccgaggccgacgtggaagtggccgaggcc
atcgactttctggagtactacgcccgcagcgccatgaagtacgcgggcttcggcagcagc
gagacgacctggttcgagggcgaggaaaacggcctgatgagtattccgctgggtgtcggc
gtgagcatcagcccgtggaatttcccctgcgcgatctacctggggatgctggccgcgccc
atcgtcgcgggcaactgtgtgatcgccaagccggccgaggacgcgggcctcatcgcgggc
ttcgtcaccgagatcatgtacgaggccgggctgcccgccggggtcctccagttcctgccg
ggggtgggcaaggaagtcggcgagttcctgaccacgcatgccaagacccgcttcgtcacc
ttcacgggcagccgggcggtgggcctgcacatcaacgaggtggcggccaaggtgcagccg
ggccagaagtggctcaagcgcgtgatcatggaactgggcggtaaggacgccatgatcgtg
gacgagaccgccgatctcgacgtggcgatcaccgccgccgtgcagggggccttcggcttc
aacggccagaagtgcagcgccatgagccgcctcgtggtggtggacgaggtgtacgacgcg
gtggtcaacggtttcgtcgagcggacccgcgcgctgaagatgggcaccggcgaggagaac
gccaacgtcaccgccgtcgtcaaccagatgagcttcgacaaggtcaagtcgtacctcgac
ctcgccccgcaggaggggaccgtgctgctgggtgggcaggcccccggcgagtacggcggc
acatccggctattacgtccagccgaccatcgtgggcgacgtgaagcgtgacgcccgcatg
gcgcaggaggaaatcttcgggccggtcgtgaccgtgctgcgcgccagggactggcaggac
gccctcgatatcgccaactcgaccgagtacggcctgactggcggcgtgtgcagccgcagc
cgcgagcggctggagcaggcccgcgccgagttcgaggtgggcaacctgtacttcaaccgc
aagatcaccggggccatcgtgggcgtgcagcccttcggcgggtacaacatgagcggcacc
gactccaaggcgggcggcccggactacctcgccaacttcatgcagctcaagaccgtgacc
gagcgctggtaa

DBGET integrated database retrieval system