KEGG   Deinococcus gobiensis: DGo_CA2628Help
Entry
DGo_CA2628        CDS       T01827                                 

Gene name
mtlD
Definition
(GenBank) Mannitol dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00051  Fructose and mannose metabolism
dgo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DGo_CA2628 (mtlD)
Enzymes [BR:dgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     DGo_CA2628 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Sacchrp_dh_NADP 3HCDH_N UDPG_MGDP_dh_N CDI
Motif
Other DBs
NCBI-ProteinID: AFD26555
UniProt: H8GTA3
Position
complement(2778040..2779212)
Genome map
AA seq 390 aa AA seqDB search
MTTSQATDPKPTAIQFGAGNIGRGFIGALLAHSGYRVVFADINEAVISALRDQGRYTVQV
LDVERRSEEVTGVTGILSNGPEIVPAVAQASLITTAVGPNVLKIIAPTLARGIEERARAG
AGDLNIIACENMVGASSFLKEQVESHLSEEGRRYADEHVGFPNSSVDRIVPPFSSENPLD
VGVEAFYEWIVERPAFKGPVPDIEGMKLTDNLVAYVQRKLFTLNNGHAVAAYLGVRRGLD
TIEASMNDPEIAAEVRAAMEQSGAALVRRYGFDPAEHAAYIDKIMGRFRNPHIRDEVLRV
GREPLRKLGAADRIVGPARMAAEYGLPTDALQRGAAAALRYDNPADPQAAQLQAMIGERG
IEAAVTEATGLEAGSDLHRGIVEAYRALGD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccacatcccaggcgaccgatccgaaacccaccgccatccagttcggggccggcaac
atcgggcgcggcttcattggcgcgctgctcgcgcacagcggctaccgcgtggtgttcgcg
gacatcaacgaggcggtcatctccgccctgcgggaccaggggcgctatacggtgcaggtg
ctcgatgtcgagcgccgcagcgaggaggtgaccggcgtgaccggcatcctctcgaacggc
cccgagatcgtgccggccgtcgcccaggcgagcctgatcaccacggcggtcggccccaac
gtcctgaagatcatcgcgccgaccctggcgcgcggtatcgaggagcgggcgcgggccggt
gcgggcgacctgaacatcatcgcctgcgagaacatggtcggggccagctccttcctcaag
gaacaggtcgagtcgcatctctcggaagagggccggcgctacgccgacgagcatgtgggc
ttcccgaattcctcggtggaccgcatcgtgccgcccttttccagcgagaatccgctcgac
gtgggcgtggaggccttctacgagtggatcgtcgagcgccccgccttcaaggggccggtg
cccgacatcgagggcatgaagctcaccgacaatctggtggcctacgtgcagcgcaagctg
ttcaccctgaacaacgggcacgccgtcgccgcgtacctgggtgtgcgccgggggctcgac
accatcgaggccagcatgaacgaccccgagatcgccgccgaggtgcgcgccgccatggag
cagagcggcgcggccctggtccggcgctacggcttcgacccggccgagcacgcggcgtac
atcgacaagatcatgggccgtttccgcaacccccacatccgcgacgaggtgctgcgcgtg
ggccgcgagccgctgcgcaaactgggggccgccgaccgcatcgtcgggccggcccgcatg
gctgccgagtacggcctgcccaccgacgccctgcaacgcggcgcggcggcggccctgcgt
tacgacaaccccgccgacccgcaggcggcccagcttcaggccatgatcggggagcgcggc
atcgaggccgccgtgaccgaggcgaccggcctggaggcgggcagcgacctgcaccggggc
atcgtcgaggcctaccgcgccctgggcgactga

DBGET integrated database retrieval system