KEGG   Drosophila grimshawi: Dgri_GH10254
Entry
Dgri_GH10254      CDS       T01061                                 

Definition
(RefSeq) GH10254 gene product from transcript GH10254-RA
  KO
K12481  rabenosyn-5
Organism
dgr  Drosophila grimshawi
Pathway
dgr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dgri_GH10254
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dgr04131]
    Dgri_GH10254
Membrane trafficking [BR:dgr04131]
 Exocytosis
  Others
   Others
    Dgri_GH10254
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    Dgri_GH10254
 Protein recycling
   Rab4 associated proteins
    Dgri_GH10254
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    Dgri_GH10254
SSDB
Motif
Pfam: FYVE Rbsn Pex16 zf-C2H2_9 zf-Di19 IF-2B zf-C2H2_4
Other DBs
NCBI-GeneID: 6561368
NCBI-ProteinID: XP_001989050
FlyBase: FBgn0117735
UniProt: B4JB25
AA seq 503 aa
MSGNPFDDEDAPSAGSDEILEGFLCPICRADLKSIDFLTEHFARQHAEEEDALKSVFKDI
FSKAKKKILNNFEDDRNRGALAGVMPTASAASAAGGASAAGAAGGGAGAFRTQLNIYSNM
AKQSVGAERSYLEYFQSVRNPRLERYASETNKLIIRLHRLLKDLPTDAVQRKHHEQQTVP
WLDGSSVKLCPNCAKSFHIARRQHHCRLCGGIMCHDCSRFLQLENAMQLASLSSTRGEPL
QQMRHHEDRAIRVCQHCLWLLDTRQDMHESRTCRPMLVHVYEEIRQLQKQVSPDLDMYVK
IVNSLLDGESIFTIADAGALRGKIGQVAEKIDLRSKRILTIHSEPGSRDEALKKAIRLSC
VQAIKERMLSLPPLPDEALISQMQERRRMETEQRILTEQRMAMEAYERYGAANQTGINTE
HRSFAQGSDLQSLNNWSAPQASTTISSVDDPLIEQINIIKGYIKQARQDMNFDVVETLEL
NLRELQREVYERQRRSSTPQLDS
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgtcgggcaatcctttcgacgacgaggacgcgccgagtgccggcagtgatgagatactg
gagggttttctctgtcccatttgccgggcggacttgaaatcgattgatttcctcaccgag
cactttgcccgccaacacgccgaggaggaggacgcgttgaagtccgtcttcaaggatata
ttcagcaaagccaaaaagaagatactcaataactttgaggatgatcgcaatcgtggtgct
ctagcaggtgtaatgccaacagcaagtgcagccagtgctgcgggaggagcaagtgcagca
ggagcagcaggaggtggagcaggagcatttaggacgcagctaaacatttatagtaatatg
gccaagcagagcgttggagcggaacgttcatatctagagtattttcaatcggtgcgcaat
ccacgcctagaacgctatgcgagcgaaacgaataaactgattattcgattgcatcgccta
ctgaaggatctgccgacggatgcagtgcagcgcaagcatcacgaacagcagacggtgcca
tggctcgatggcagttccgtcaagctatgccccaactgcgccaagagctttcacatcgca
cggaggcagcatcactgtcgcctctgcggcggcatcatgtgtcacgattgctcccgattt
cttcagctagaaaatgccatgcaattggccagtttgtcgtcgacacgtggcgagccactg
cagcagatgcgccaccatgaggatcgggcgattcgtgtgtgccagcattgcctgtggctt
ctggacacgcgccaggacatgcacgagagtcgcacctgccggccgatgctcgttcacgtg
tacgaggagataaggcagctgcagaaacaggttagtcccgatctggacatgtacgtaaag
attgtgaatagtctgctcgacggcgaatcgatattcaccattgccgatgcgggcgccttg
cgtggcaagatcggtcaggtggccgagaaaattgatttgcgtagtaaacgcattctcacc
atccactcggagccgggcagccgcgacgaggcgctgaaaaaggccattcgcctgagttgt
gtgcaggcgatcaaggagcgaatgttgtcgttgccaccgctaccggatgaggcgctcatc
agtcagatgcaggagcgcagacgcatggagaccgaacaacgcattctcaccgagcagcgt
atggccatggaggcctacgagcgttacggtgccgcaaaccaaaccggaattaatacggag
caccgcagttttgcccaaggctctgatttgcaatcgttgaataattggtcagcgccgcaa
gcgtccacaacaatttccagcgtcgatgatccgctcatcgagcagatcaacattattaag
ggctacattaaacaggcgcgtcaggacatgaacttcgatgtggtggagaccctggaactg
aatctgcgcgaactgcagcgagaggtgtacgagcggcaaaggcgtagcagcacaccccag
ttggacagctag

DBGET integrated database retrieval system