KEGG   Drosophila grimshawi: Dgri_GH10596Help
Entry
Dgri_GH10596      CDS       T01061                                 

Definition
(RefSeq) GH10596 gene product from transcript GH10596-RA
  KO
K18669  dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dgri_GH10596
Protein kinases [BR:dgr01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   Dgri_GH10596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Choline_kinase Kdo RIO1 TFIIF_alpha
Motif
Other DBs
NCBI-GeneID: 6562855
NCBI-ProteinID: XP_001988388
FlyBase: FBgn0118077
UniProt: B4JD82
AA seq 729 aa AA seqDB search
MLDRCEMPIQLDNEKLRRDVRLSSSRLDLPQLCNVGRRLDGHINSNNNNSSNHVNEMTTT
QNGNGSNMNNNNNNNLGSPVSCSTTNSSSGNERGSSTKSNSSSGSGSSGNSASSTGSAEL
KCNTPMTPLELVKKYRNYLTDLECEELKVYKEVWYFGQHASKNYNRPAPTANTTNLGYDD
DNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVV
ELNILDELREKDADGSHNVIHMLDYTYFRRHLCITFELMSLNLYELIKKNNYNGFSMSLI
RRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQS
RFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVL
ISVARRRRLFFDSRDAPRCITNTKGRKRAPGSKSLSQILHCQDRYFIDFLQRCLEWDPAE
RMTPDEAAHHEFLQPSASSRHRSCRMSTSSSSSGLNSVSQKSSCYNFAEISPGSGPVVAS
ITSTTAVSNAAITTKSSSSSRQPHSHAQSNGHLPDIKLSASDKYNSMQKVAVRSKITSSV
SDLESVQQYSLHRIYGGIGSGSTHHVSSAATRKHLNGNPSVVGVGGNVSNSSKYGSSTLA
HNHHNVTHHNASTATIATATHHHHHHGIAVGQQSGLGGVSQQGGVGANVAMSHSQSTGDV
SDRAIFGRA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcgatgtgaaatgcctatacaattggacaacgagaagctgcggcgcgatgtg
cgtctgtccagctcgcgcctggacttgccacagttgtgcaatgtcggacgtcgtctcgat
gggcacattaacagcaacaacaacaacagcagcaatcatgttaacgagatgacaacaaca
cagaatggcaatggcagtaacatgaacaacaacaacaacaacaaccttggctcgccggtc
tcctgctcgaccacaaacagcagcagtggcaacgagcgtggctcctcgaccaaatcaaac
agcagcagtggcagcggcagctcgggcaactcggcaagcagcactggcagtgccgagctc
aaatgcaacacgcccatgacacctttagagctggtcaaaaaatatcgcaattatttgact
gacctggagtgtgaggagctgaaggtgtacaaggaggtctggtattttggccagcacgcc
agcaagaactacaatagacccgccccgacagccaataccacaaatttgggctatgacgat
gataatggcaattacaagatcattgaacacgatcatatagcctttcgctacgagatcttg
gaggtgattggcaaggggagctttggccaggtgatcagagcacttgatcacaagacaaac
acacacgttgccatcaaaatcataaggaacaagaagcgtttcctcaaccaggcagtcgtt
gagcttaacatactcgatgagttgcgcgaaaaggatgccgatggatctcataacgtaata
cacatgctggactatacatatttccgtagacatttgtgcattaccttcgagctaatgagt
ttgaatctctacgagctgatcaagaagaataactataatggtttcagcatgagtttaata
cgacgcttctgcaattcgattgtgaaatgcctgcgtttgctctacaaagagaatatcata
cactgtgatctcaagccggaaaacattttgctgaaacaacgcggcagcagctcgattaaa
gtcatcgattttggcagctcgtgctatgtggaccggaaaatctatacatacatccaatcg
agattctatcgctccccggaggtgatacttggactgcaatatggcaccgccattgacatg
tggagcttgggctgcattttggctgagctatatacgggcttcccactgtttcccggcgag
aacgaggtggagcagctggcctgcattatggaggtgctgggtctgccacccaaggtgctc
atctcggtggctcgtcgtcgtcgcctgttcttcgattcgagagatgcgccacgttgcatt
acgaatacgaagggcaggaaacgtgcgccgggcagcaagtctctgtcacagatactgcac
tgtcaggatcggtattttattgactttctgcagcgttgcttggaatgggatcctgcggag
cgtatgacgccggatgaggcggcgcatcatgagttcctgcagccatccgcgtcgagtcgc
catcgcagttgccgcatgtccacgagctcctcgagctccggactgaacagtgtctcccag
aaatcctcctgctacaactttgcagagatctcgcccggcagcgggccagtggtggcctca
atcacgagcaccacagctgtgagcaatgcagccataacgaccaagtccagctccagttcg
cgtcagcctcactcccatgcccagtccaatggacacctgcccgacatcaagctgagcgcc
agcgacaaatacaacagcatgcagaaggtggcggtccgctcgaagatcacgtcgagcgtc
tcggatctggaatcggtgcagcagtattcgctgcatcgcatctacggtggcattggcagc
ggcagcacacatcacgtctcctcggcggcgacccgcaagcatctgaatggcaacccaagc
gttgttggtgtcggtggcaacgtcagcaacagcagcaaatatggcagcagcacgctggcg
cacaatcatcacaatgtcacgcatcacaatgcctccacggcaaccatagcgacagcaacg
catcatcatcatcaccatggcatcgctgttgggcagcagagtggtttgggtggggtgagc
cagcagggcggcgttggcgctaatgtggccatgtcgcattcacagtccaccggtgatgtt
tccgatcgagccatctttgggcgtgcttga

DBGET integrated database retrieval system