KEGG   Drosophila grimshawi: Dgri_GH10708Help
Entry
Dgri_GH10708      CDS       T01061                                 

Definition
(RefSeq) GH10708 gene product from transcript GH10708-RA
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00562  Inositol phosphate metabolism
dgr01100  Metabolic pathways
dgr04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dgri_GH10708
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    Dgri_GH10708
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dgr01009]
    Dgri_GH10708
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     Dgri_GH10708
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     Dgri_GH10708
Protein phosphatases and associated proteins [BR:dgr01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    Dgri_GH10708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM Y_phosphatase DSPc Y_phosphatase3 3-PAP
Motif
Other DBs
NCBI-GeneID: 6561471
NCBI-ProteinID: XP_001988177
FlyBase: FBgn0118189
UniProt: B4JC31
AA seq 613 aa AA seqDB search
MDATSSLADKLASKTASSNSLDSSSKSSSLGSKQGAENGVLRDTPFAYLDGEEDQDQKND
VTYVCPYRGPVFGALTITNYRLYFRSLPLRDQEPPVVIDVPLGVIARVEKIGGATSRGEN
SYGIEIFCKDMRNLRFAHKQQNHSRRTVFEKLQWNAFPLSYTGKLFAFTHGAVSASWDGW
SVYEPLAELRRLGVPNDMWRATKLNESYAICDSYPAVWAVPKAASDDILRRVAQFRSRCR
LPVLSWMNPRTQATITRCSQPLVGVSGKRNADDEAYLSYIMEANAQSDKLTIMDARPSAN
AIANKAKGGGYESEDAYKNVEINFLDIHNIHVMRESLRKVKEACYPTTDDSKFQSVIDST
LWLKHLCCVLAGAVRIVDKVETMSTSVVVHCSDGWDRTAQLTALSMLLLDPYYRTVRGFE
VLIEKEWLSFGHKFQQRIGHGDNKHSDADRSPVFLQFIDCVWQVSWQFKNAFEFNEYFLI
TIVDHLYSCRFGTFLCNTEAERVTDDLKHKTTSLWTHINSSLDQYLNPLFPASSDRAELV
LRPIASTRIIRLWKGLYCRWNPGLCTPQHGCQRTRELLSKQDQLFKHVNDLRLKLINRIG
NTQTTTRLASPMR
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggatgccacatcaagcttagccgacaagttggcatcgaaaacggccagcagcaactca
ctggacagcagctccaagtcaagttccctgggctccaagcaaggtgctgagaacggtgtg
ctgcgagacacgccctttgcctacctggacggtgaggaggatcaggaccaaaaaaacgat
gtgacctatgtatgtccgtatcgtggacccgtttttggtgcactcaccattaccaattat
cggttgtattttcgttcactgccgctgcgcgaccaagagccgcccgtcgtcatcgatgtg
ccgctgggtgtgatagctcgcgtagagaaaatcggtggcgccacgtcgcgcggcgagaac
agttatggcattgagattttctgcaaggacatgcgaaatctacgctttgcgcacaaacag
caaaatcactcgcgtcgcaccgtattcgaaaaattgcagtggaatgcatttccgctgtcc
tatacgggaaaactgttcgccttcacccatggggcagtgagcgccagctgggatggctgg
tcagtgtatgagccgctggcggagctgcgtcggctgggcgtgcccaatgatatgtggcgg
gcgacgaagctaaacgaatcctatgccatttgcgatagctatccggctgtgtgggccgta
cccaaggccgcctcggatgacattttgcgtcgcgttgcacagttccgttcgcgttgccgt
ctgcccgtcctgtcctggatgaatccacggacgcaggcaaccataacgcgctgctcccag
ccgctggtgggcgtcagtggcaaacggaatgcagatgatgaggcgtatctcagctacatt
atggaggccaatgcacagtcggacaagctgactatcatggatgcgcgtcccagtgcgaat
gccattgccaataaggccaaaggcggcggctatgagtctgaggatgcctacaagaatgtg
gagatcaatttcctagacatacacaatatacacgtgatgcgcgagagtttgcgcaaggtg
aaggaggcctgttatccaaccaccgatgactccaaatttcagtcggttatcgatagcacc
ttgtggctgaagcatctgtgctgcgtcctagctggcgctgtgcgcattgtggacaaggtc
gaaacaatgagcacttctgtagtggtgcactgctccgatggctgggatcgcactgcacag
ctgacggctctatcgatgctgctcctggatccatattatcgcaccgtgcgcggttttgag
gtcctcatcgagaaggagtggctgtcgttcggtcacaaattccagcagcgtatcgggcat
ggcgacaacaagcactcagatgcagatcgctcaccagtgttccttcaatttattgattgc
gtgtggcaagtgagttggcagtttaaaaatgccttcgagttcaatgagtatttcctcatt
accattgtggatcatctgtattcgtgccgctttggaaccttcctatgcaacaccgaggcg
gagcgggtcacagatgatctgaagcacaaaacaacatcactgtggacgcacattaattcg
tcgctggatcagtatctgaatccgctgtttccagcctcctcagatcgggccgagctcgtg
ttgcgtcccattgccagcactcggatcatacgtctgtggaagggtctctactgccgttgg
aatccgggattgtgtacgccacagcatggctgccagcgcacaagggaactgctatcgaag
caggaccagctctttaagcatgtcaacgatctgcgcctgaagctcatcaatcgcattggc
aatacgcagacgaccacacgattggcgtcgcccatgcgttaa

DBGET integrated database retrieval system