KEGG   Drosophila grimshawi: Dgri_GH11313Help
Entry
Dgri_GH11313      CDS       T01061                                 

Definition
(RefSeq) GH11313 gene product from transcript GH11313-RA
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
dgr  Drosophila grimshawi
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dgr04131]
    Dgri_GH11313
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dgr04147]
    Dgri_GH11313
Membrane trafficking [BR:dgr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    Dgri_GH11313
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dgri_GH11313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Thioredoxin_2
Motif
Other DBs
NCBI-GeneID: 6562222
NCBI-ProteinID: XP_001988715
FlyBase: FBgn0118793
UniProt: B4JE62
AA seq 386 aa AA seqDB search
MILPLESSTPLLSASIVLEITKSNFNSTVHSHKLVFINFYADWCHFSNRLTPIFEEAAVR
LAEDLPPEASVRLARVDCMREMELANLCSITKFPTLLLYYRGQPLRQEYRGQRSVEALVA
HVQKQLRLTIKTLDNVQELNMIDVKRRTVIGFFESRKKPDAGIFELVADRYKNDCDFYVR
VGAKLDDMTYTHYMPTIVFRPDVERTHAADEVFAGNPSSLPELEKWVFKKCVPLVREVDF
GNVEEIIEQRLPLLVLFHMPNDVDSVKDFKSIVEMQLVSCSDCGRFNFVTVDGLKFQHSV
QHIGKTVHDLPFIAIDSLKYMFPYSKFKDMYIPGHLKQFLQNFSSHQLQHKLHLTKDQDK
NLPPLSTFKELGPSKHRYTLVEHDEL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgattttgccgcttgagtcgtcaactccattattatcagcgtctattgtattagagatc
acaaagtccaattttaatagtacggtacactcgcataagttggtatttataaatttctat
gcggattggtgccacttcagtaatcggctgacaccaatttttgaggaggcagctgtgcga
ctggctgaggatctcccgccggaagcaagtgttcgtctggcacgtgtggattgcatgcgt
gaaatggagttggccaatctctgcagcattaccaagtttcccactctacttctgtattat
cgtggtcaaccgctacgtcaggagtatcgtggacagcgttccgttgaggcactggtcgcc
catgtgcagaagcagcttcgattgacgattaaaacattggataatgtgcaagaattgaat
atgatcgatgtgaagaggcgcactgtgattggcttctttgagagccgcaagaagcccgat
gcaggaatctttgagctggtggcggaccgttataaaaacgattgtgatttctatgtgaga
gtcggcgcaaagctggacgacatgacgtacacgcattatatgccaacgattgtctttcgt
ccggatgtggaacgcacccatgccgcggatgaggtctttgccggcaatccctcatctctg
ccagagctggagaagtgggtcttcaagaagtgtgtgccgctagtgcgggaggtggatttc
ggtaatgtggaggagataatcgaacaacgactgccgctgctggtgctctttcacatgccc
aacgatgtggactcggtgaaagatttcaagtcgattgtggagatgcaattggtgagctgt
tcggattgtggacgtttcaattttgttaccgtcgacggtctgaagtttcagcattcggta
cagcacattggcaaaacagtgcatgatctaccattcatcgccatcgattcgctaaagtat
atgtttccctattccaaatttaaggatatgtatataccaggtcatctcaagcaattcctt
caaaacttcagcagtcatcaactgcagcacaagttgcaccttacaaaggatcaagataag
aacttgccgccgttatccaccttcaaggaactgggaccctcgaagcatcgctatactctg
gtcgaacatgatgagctgtga

DBGET integrated database retrieval system