KEGG   Drosophila grimshawi: Dgri_GH11375Help
Entry
Dgri_GH11375      CDS       T01061                                 

Definition
(RefSeq) GH11375 gene product from transcript GH11375-RA
  KO
K08738  cytochrome c
Organism
dgr  Drosophila grimshawi
Pathway
dgr04214  Apoptosis - fly
dgr04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dgri_GH11375
   04215 Apoptosis - multiple species
    Dgri_GH11375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 6561895
NCBI-ProteinID: XP_001988828
FlyBase: FBgn0118855
UniProt: B4JEH5
AA seq 103 aa AA seqDB search
MGADAENGKKIFVQKCAQCHTYEGGKHKQGPSLAGVVGRKCGTTAGYKYTDANMKRAVVW
TEGNLDEYLKDPKKYIPGTKMVFPGLKKAEDRADLIAFLKQNK
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccgatgcggagaatggcaaaaagattttcgttcagaaatgcgctcagtgccac
acatatgaaggtggtaagcacaagcagggtcccagtttggctggagttgttggccgcaag
tgtggcacaaccgctggctacaaatataccgatgctaatatgaaaagggccgtcgtctgg
actgaaggcaacctcgatgagtatctaaaggatccaaagaaatatatacctggtactaag
atggtttttcccgggctcaagaaagctgaagatcgcgctgatttgattgcattcctcaaa
caaaataaataa

DBGET integrated database retrieval system