KEGG   Drosophila grimshawi: Dgri_GH12104Help
Entry
Dgri_GH12104      CDS       T01061                                 

Definition
(RefSeq) GH12104 gene product from transcript GH12104-RA
  KO
K01476  arginase [EC:3.5.3.1]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00220  Arginine biosynthesis
dgr00330  Arginine and proline metabolism
dgr01100  Metabolic pathways
dgr01230  Biosynthesis of amino acids
Module
dgr_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Dgri_GH12104
   00330 Arginine and proline metabolism
    Dgri_GH12104
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Dgri_GH12104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 6564948
NCBI-ProteinID: XP_001991347
FlyBase: FBgn0119583
UniProt: B4JK69
AA seq 354 aa AA seqDB search
MWWTTRRIVIKCLQHQRFLSAAAAAGPEAQTLGIIGVPFAKGQAKQGVELAPDLLRQNKL
RQVLQNSDERLVITDYGNLPYAVDETLLQQQRQHYYHIRNYADFMACNLALIGQVQLMLQ
QNAQFLAIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLL
EPLRPTWQHASLDKIAPNCLPKDQLVYIGLRDIDPYEAFILNKFGIRHYAMDSIDRVGVP
KIIEMTLDALNPQNKIHVSFDIDALDSNVAPSTGTAVRGGLTLREGISIVEALRDTKRVQ
GMDLVEINPKLGSEHDVRTTVESGLEILKSMFGYRRSGARIYSNLDTGILGHEH
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggacaacgcgacgaatagtaatcaagtgcctccagcaccaacgctttctgagc
gctgcggctgcggctgggcctgaggcacaaaccctgggcatcatcggtgtgccctttgcc
aaggggcaggcaaagcagggcgttgagctggcgcccgatttgctgcgccagaataaactg
cgtcaggtgctgcaaaacagcgatgagcgcctggtgataacggactatggcaatctgccg
tatgccgtggatgagacactgctgcagcagcagcgccaacattattatcacatacgaaac
tatgcggatttcatggcctgcaatctggcgttaattggccaggtgcagctgatgctgcag
cagaatgcacagttcctggccattggcggtgatcatgccatcggctttggctccgtggcg
ggtcatttgcagcacacgccgaacctgtcgctggtgtggatcgatgcgcacgcggacatc
aatttgcacagtacctcgcagtcgggcaatatacatggcatgcccgtttcgttcctgctg
gaaccgctgcggccaacctggcagcacgcgtcgctcgacaagatcgcgcccaattgtttg
ccaaaggatcaattggtttacattggcttgcgggacattgacccctacgaggcgttcata
ttgaataagtttggaatacgccactatgccatggattctatcgatcgtgtgggcgtgccc
aagatcattgagatgacgctggatgcactgaatccgcagaacaagatccatgtgagtttc
gatatcgatgccctggacagcaatgtggcgccgagtacgggcactgcggtccgcggtggc
ttaaccttgagagagggcatcagcattgtggaggcgctgcgcgacacgaaacgtgtgcag
ggcatggatctggtcgagatcaatccgaagctgggcagcgaacatgatgtgcgcaccacc
gttgaatccggcctggaaatactcaagagcatgttcggctatagacgatccggtgcgcgt
atctacagcaatctggatacgggcatactgggacacgagcactaa

DBGET integrated database retrieval system