KEGG   Drosophila grimshawi: Dgri_GH13058Help
Entry
Dgri_GH13058      CDS       T01061                                 

Definition
(RefSeq) GH13058 gene product from transcript GH13058-RA
  KO
K10739  replication factor A2
Organism
dgr  Drosophila grimshawi
Pathway
dgr03030  DNA replication
dgr03420  Nucleotide excision repair
dgr03430  Mismatch repair
dgr03440  Homologous recombination
dgr03460  Fanconi anemia pathway
Module
dgr_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dgri_GH13058
   03420 Nucleotide excision repair
    Dgri_GH13058
   03430 Mismatch repair
    Dgri_GH13058
   03440 Homologous recombination
    Dgri_GH13058
   03460 Fanconi anemia pathway
    Dgri_GH13058
DNA replication proteins [BR:dgr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Dgri_GH13058
DNA repair and recombination proteins [BR:dgr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Dgri_GH13058
   MMR (mismatch exicision repair)
     Dgri_GH13058
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Dgri_GH13058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon RNA_pol_Rpc34 MarR
Motif
Other DBs
NCBI-GeneID: 6566893
NCBI-ProteinID: XP_001993462
FlyBase: FBgn0120535
UniProt: B4JR57
AA seq 240 aa AA seqDB search
MNDSFGDFNATQTATAGATKESSGEGIISLLVKQILDSPEGNFKMFDVAYALVCAVGIVR
NIETSSTKITYSIEDHSGRIDAHYWLEEGDAIKSPDVMLNNYVKIYGSVRSQAGQKVLMV
FKLLNVLDPNEVCTHVLEALHSRYKAEEYNHKGDGGPSNQLMPNVTASQSNAIVAGLDSK
QLAVFQAIKSNCSEEGIHRRELSAKFSHISQSEMTNILDFMISEGHIYSSIDPDHFICTM
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcttttggtgatttcaatgccacacaaacggccacagccggcgccacaaag
gaatcctctggcgagggcattatttcattgctggtcaaacagattcttgattcgcccgag
ggcaatttcaagatgttcgatgtcgcctacgctttggtctgcgccgttggaattgtgcgc
aatattgagacgtcatcgacgaagattacttattctatagaggatcacagtggtcgcatc
gatgcacactactggctggaagagggcgatgccatcaagtcacccgatgttatgctcaat
aactatgtgaaaatctatggttccgtgcgttcgcaggcgggtcaaaaagttctgatggtc
ttcaagctgttaaatgtgctcgatcccaacgaggtgtgcacccacgtgctggaagcgctc
cattcgcgctacaaggctgaggagtacaatcacaaaggtgacggaggtccgagcaaccaa
ctgatgcccaatgtgacggccagtcaaagtaatgccattgtcgccggtctggacagcaag
cagctggctgtcttccaggccatcaagagcaactgctctgaggagggcattcatcggcgc
gaactgagcgcaaagttctcgcacatcagccagtccgagatgacaaatattttggacttt
atgatatccgaggggcatatttattccagtatcgatccggatcatttcatatgcaccatg
tag

DBGET integrated database retrieval system