KEGG   Drosophila grimshawi: Dgri_GH14861Help
Entry
Dgri_GH14861      CDS       T01061                                 

Definition
(RefSeq) GH14861 gene product from transcript GH14861-RA
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dgri_GH14861
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dgri_GH14861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Abhydrolase_6 Hydrolase_4 FSH1 Abhydrolase_1 DLH Abhydrolase_3 Cutinase Peptidase_S9 DUF2974 Lipase_3 Esterase
Motif
Other DBs
NCBI-GeneID: 6558489
NCBI-ProteinID: XP_001984733
FlyBase: FBgn0122337
UniProt: B4J2J6
AA seq 216 aa AA seqDB search
MSAPVIVEATAKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGF
RMPSWFDLKTLDIGGPEDEPGIRAARDDVHTMIQKEVNAGIPANRIVLGGFSQGGALALY
SALTFAQPLAGVVALSCWLPLHKQFPGAKISSDEVPIFQAHGDYDPVVPYKFGQLSASLL
KSFMKNVTFKTYSGLSHSSSDEEMSDVKDIISKWVN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaccggtaattgtcgaggcaacggccaaacaaacagcaacgctcatcttcatg
cacggcttgggcgacactggccatggctggagcagtgctttggctgctatacgtccaccg
ttcatgaaggtgatttgtccgacggcaccaacacagcccgtctcgttgaatgccggcttt
cgcatgccgtcgtggttcgatttgaagaccctggatattggcgggccggaagatgagccg
ggcatacgtgcggcccgtgacgatgtgcacacaatgatacagaaggaggtgaacgccggc
ataccggccaatcgcattgtgctcggcggtttctcgcagggcggcgccttggctctctac
tcggctctgacctttgctcaaccgctggccggtgttgtggcactctcgtgttggctgcca
ctgcacaagcagttccccggcgccaagatcagcagcgatgaggtgcccatattccaagcg
cacggagattatgatcccgttgtgccttataaatttggccaactcagcgccagtctgctc
aagtcgttcatgaagaatgtcacctttaaaacgtacagcggactctcgcactcctcatcc
gatgaggagatgagcgatgtaaaggacataatcagtaaatgggtaaactaa

DBGET integrated database retrieval system