KEGG   Drosophila grimshawi: Dgri_GH15034Help
Entry
Dgri_GH15034      CDS       T01061                                 

Definition
(RefSeq) GH15034 gene product from transcript GH15034-RA
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
dgr  Drosophila grimshawi
Pathway
dgr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    Dgri_GH15034
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     Dgri_GH15034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-GeneID: 6568142
NCBI-ProteinID: XP_001994630
FlyBase: FBgn0122509
UniProt: B4JUT9
AA seq 362 aa AA seqDB search
MRLICLLLLAAASIQVCLGENKVSCKDEEGHDVDWWYIYKLPKHYSTLYQGADVSGLRYF
FVTSSSYDSWQLSGKRISDSNSLAAETLRPLYADTQHVLLAAYNDEFPNGTVTSTGGHTK
GVIATDGVTGVWLVHSVPKFPTVPDYTYPTSGENYGQSLLCMTLDMEGVEKVGELLVYNE
PHFYYTRNPLLKAAELVPSLERALKQQWRTEEPYQKEIEVKTLNGKQFRLFGKSSRANVE
LYSDVVAPALGVNLFVEAWRDGAGSLPDSCDKANKVYNVQDIANEDFRIEFKTTGDHSKW
AVSEESGIKLHRWRIGGGDWICIGDINRQRSQQNRGGGTACHKSSRVSDLYRKLVANYEK
CN
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgatttgtctgctgcttttggcagctgcctcgatacaggtttgccttggcgaa
aacaaagtgtcctgcaaggacgaagagggtcacgatgtcgactggtggtacatttacaag
ttgcctaagcactactcgaccctatatcagggtgcggatgtgagtggattgcgatacttc
ttcgtgaccagcagctcctatgacagctggcagttgtctgggaagcgcatcagcgactcc
aactcgctagcagcggaaacactgagaccgctctacgcagacacacagcatgtgctgctg
gctgcgtacaacgatgagtttcccaacggtaccgtcaccagcactggtggccacacaaag
ggtgtcattgccaccgacggagtgacaggtgtttggcttgtgcactcggtgccgaagttt
ccaacagtgccggattatacgtacccaaccagtggcgagaactatggccagagtctgctc
tgcatgacgctcgatatggagggtgtggagaaggtgggcgaactgttggtctacaatgag
ccgcatttctactacacgcggaatccgctgctgaaggctgctgaactagtacccagcctg
gagcgtgcactcaagcagcagtggcgcactgaggagccgtaccagaaggagatcgaggtg
aagacactcaatggcaaacagttccgtctctttggcaagagttcgcgcgccaatgtcgag
ctctactcggatgtggttgctcccgccctgggcgtcaatctgtttgtggaggcttggcgc
gatggtgccggcagtttgcccgacagctgcgacaaagccaacaaggtctacaacgttcag
gatattgccaatgaggatttcaggatcgagttcaagaccacgggagaccattccaagtgg
gccgtctccgaggaatcgggtattaaactgcatcgctggcgcattggtggcggcgattgg
atctgcatcggcgacattaatcgccagcgaagtcagcagaatcgcggaggcggcaccgcc
tgccacaagagctcgcgtgtctcagatctctatcgcaaactggtcgccaactatgaaaag
tgcaactaa

DBGET integrated database retrieval system