KEGG   Drosophila grimshawi: Dgri_GH16428Help
Entry
Dgri_GH16428      CDS       T01061                                 

Definition
(RefSeq) GH16428 gene product from transcript GH16428-RA
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00020  Citrate cycle (TCA cycle)
dgr00640  Propanoate metabolism
dgr01100  Metabolic pathways
dgr01200  Carbon metabolism
Module
dgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dgri_GH16428
   00640 Propanoate metabolism
    Dgri_GH16428
Enzymes [BR:dgr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     Dgri_GH16428
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dgri_GH16428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 6558392
NCBI-ProteinID: XP_001984386
FlyBase: FBgn0123899
UniProt: B4IZW2
AA seq 328 aa AA seqDB search
MAASMRALLKVRDGFVTGVRCGSQYNKTRGNLKLNGDSRVICQGFTGKQGTFHSQQALEY
GTKLVGGISPKKGGTQHLGLPVFASVADAKKATDPHATVIYVPPPGAAAAIMEALDAEIP
LIVCITEGVPQHDMVKVKHALISQDKSRLVGPNCPGIIAPEQCKIGIMPGHIHKRGKIGV
VSRSGTLTYEAVHQTTEVGLGQTLCVGIGGDPFNGTDFIDCLEVFLKDPETKGIILIGEI
GGVAEEKAADYLTEFNTGIKAKPVVSFIAGVSAPPGRRMGHAGAIISGGKGGANDKIAAL
EKAGVIVTRSPAKMGYELFKEMTRLELV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggccgcttcaatgagagcgttactcaaagtgcgagatggcttcgttacgggcgttcgc
tgtggctcgcagtacaacaagacgcgtggaaacctgaagctgaatggtgattcccgtgtg
atctgtcagggcttcaccggcaaacagggcacgttccacagccagcaggcgttggagtat
ggcaccaaattggtcggcggcatttcacccaagaagggcggcactcagcatttgggtctg
cccgtttttgcctctgtggccgatgcgaagaaggcaacggatccgcatgccactgttatc
tatgtgccaccgcctggtgccgctgctgccattatggaggcattagatgccgaaattcca
ttgattgtgtgcattacggagggtgtgccccagcacgatatggtcaaggtgaagcatgcc
ctaatctcccaggacaaatcgcgtctcgtcggtcccaattgccccggcatcattgcaccc
gaacagtgcaaaatcggcattatgcccggccatatacacaagaggggcaagattggagtc
gtgtcccgatcgggcaccctcacctatgaggcggtgcaccagaccaccgaggtgggcctg
ggccagacgctgtgcgtgggcattggtggtgatccgttcaacggcacagatttcatcgat
tgcctggaggtgttcctcaaggatcccgaaaccaagggcatcattctgattggtgagatc
ggtggtgtcgctgaggagaaagctgccgactacttgactgagttcaatacgggcatcaag
gccaagcctgtggtgtcgtttattgctggcgtttcggcgccacctggtcgtcgcatgggt
cacgccggtgccatcatctcgggtggcaagggcggtgccaatgataagattgccgcactg
gagaaggccggcgtcattgtgaccagaagtcctgccaaaatgggttacgagctgttcaag
gagatgacgcgcctggagttagtttag

DBGET integrated database retrieval system