KEGG   Drosophila grimshawi: Dgri_GH16518Help
Entry
Dgri_GH16518      CDS       T01061                                 

Definition
(RefSeq) GH16518 gene product from transcript GH16518-RA
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00010  Glycolysis / Gluconeogenesis
dgr00620  Pyruvate metabolism
dgr00640  Propanoate metabolism
dgr01100  Metabolic pathways
dgr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgri_GH16518
   00620 Pyruvate metabolism
    Dgri_GH16518
   00640 Propanoate metabolism
    Dgri_GH16518
Enzymes [BR:dgr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dgri_GH16518
Lipid biosynthesis proteins [BR:dgr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dgri_GH16518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 6556453
NCBI-ProteinID: XP_001984534
FlyBase: FBgn0123989
UniProt: B4J127
AA seq 670 aa AA seqDB search
MPAEKSIFNPNPAISRNAYISSFEEYTKFYQESLDNPAEFWSRVAKQFHWETPADPTKFM
QYNFNISKGPISIKWMDGASTNICYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRK
LLEEVCRFANVLKDHGVQKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLA
ERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQ
DNHVEQDIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTA
GYLLYAATTFKIVFDYKPGDIYWCTADVGWITGHTYVVYGPLANGATSVIFEGTPFFPGN
DRYWSVIDKYKVTQFYTAPTAIRALMKFGDAPVLKHNLSGLKVLGSVGEPINPEAWLWYY
RIIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGAASFPFFGVKATLLDECGIEIKGE
GEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDM
LNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPIKGECLYCFITPNENEPFDQKLIADL
KKMVRERIGPFAQPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQ
LFANRPVETK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgccagcggaaaaatcaatattcaatccgaatccggcaattagccgcaatgcttacata
tccagttttgaggagtacacgaaattctatcaggaatccttggacaatccagcggagttt
tggtcgcgtgtcgctaaacaattccactgggaaacgcccgcagatcccacgaaattcatg
caatacaatttcaatatctccaaaggaccaatctcaattaaatggatggacggcgcctcg
accaacatctgctacaatctcctagatcggaatgtgcgcaacggactcggagatcagata
gcttactactgggagggcaatcacccggatgattattcacgtggactcacctaccgcaaa
ctgctcgaagaggtttgtcgcttcgccaacgtgctgaaggatcatggagtgcagaagggc
gatcgcgtctccatctatatgcccatgatcctggagctgcccattgcgatgctggcctgc
gctcgcatcggcgccgtccattcgattgtgtttgcgggcttctcgcccgattctttggcg
gagcggatgttcgattgcaaggcgaaactgctgattacggccgatggggcttggcggggc
gagaaaccgctgtacctgaaggccctgtgcgatacggcactggaaaaggtcgaggagatg
ggccactcggtggagaagtgcattgtggtgtcgcatctgaagcgtgtgacaccctgccag
gataatcatgtggagcaggacattccatggaccgatgatcgcgactactggtggcacgag
gagatggaggacaaggagcccgcctgctatcccgaatggatggatgccgaggatccattg
ttcatgctctacacgagtggatccaccggcaagcccaaaggtgtgctccacaccacagct
ggctatcttctgtatgcggcgaccacattcaagattgtgtttgactacaagcccggtgac
atctactggtgcacggccgatgtcggctggatcaccggacacacctacgttgtctatggg
ccactggccaatggcgccacttcggttatcttcgagggcactccattctttccgggcaat
gatcgctactggagcgtcatcgacaagtataaggtcacccaattttatacggctcccaca
gcgattcgggcgctcatgaaatttggcgatgctccggtgctcaagcacaatctttccgga
ctcaaggttttgggcagcgttggtgagccaattaatccggaggcttggctgtggtattac
cgcatcattggcaaggagcagtgctccattgtggacacattctggcaaacggagactggt
ggacatgtcattacgcccctaccaggtgccacgcccatgaagccgggcgctgcttcgttt
ccgttctttggcgtcaaggccacgctgctggacgagtgcggcattgagatcaagggcgag
ggcgagggctacttggtgttctcgcagccctggccgggcatgatgcgcactctgtacaac
aatcatgagcgcttcgaggatacatatttctccaagttcccgggctactattgcaccgga
gacggtgcccgtcgcgatgctgatggttatttgtggataactggccgcgtggatgacatg
ttgaacgtgtccggtcatctgatgtcaactgccgaggtggagtctgttctcacggagcat
ccacgtgtcgccgaatcggctgtggtctctagaccccatcccattaaaggcgagtgcctc
tactgcttcatcacgcccaatgagaatgagcccttcgatcaaaaactaattgccgacctc
aagaagatggtgcgcgaacgcatcggaccctttgcccagccggatgtcatccaaaatgca
cccggattgcccaagacgcgctccggcaagataatgcgtcgtgtgctgcgcaagattgct
gtcaacgatcgcaatgtgggcgacacatccacactggccgacgagcagattgtggagcag
ctgttcgccaatcgtcccgtagagaccaagtaa

DBGET integrated database retrieval system