KEGG   Drosophila grimshawi: Dgri_GH17105Help
Entry
Dgri_GH17105      CDS       T01061                                 

Definition
(RefSeq) GH17105 gene product from transcript GH17105-RA
  KO
K08817  cell cycle related kinase [EC:2.7.11.22]
Organism
dgr  Drosophila grimshawi
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dgr01001]
    Dgri_GH17105
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Dgri_GH17105
Protein kinases [BR:dgr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   Dgri_GH17105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase APH Pkinase_fungal Kdo DUF3896
Motif
Other DBs
NCBI-GeneID: 6568521
NCBI-ProteinID: XP_001994437
FlyBase: FBgn0124575
UniProt: B4JU96
AA seq 295 aa AA seqDB search
MEDYAPSRYKMQDKIGEGVHGCVFKAIDLQRNMEVAIKKVALKNKFGNISLNTLREIKTL
QLCNSEYILNILEIYPDLTGLSLVLEYMPDTLYSRLKSEMNPLSRQQVRKYSLMMFKGMA
YLHEAGIMHRDIKPANLLISQTDVLKIADFGLARLYFPDEEARLYSPQVSTRWYRAPEIL
WGSQKYGTAVDLWACGNVLAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNEWPELTALP
DYSKIRFPNSVGIHWDNLFPSCTHAVEIDLVSNLVVYNPKNRLKATEAVEHSYFN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaggactatgctccaagtcgctataaaatgcaggataaaatcggtgaaggtgtccac
ggttgcgtattcaaggccatcgatttgcagcgcaacatggaggtggcaatcaaaaaggtg
gcactgaaaaacaaatttggcaatatttcactaaatacgctgcgcgagattaaaacgcta
caactatgcaattcggaatatatcttaaacatacttgagatatatcccgatctgacgggt
ctttcgctggtgctggaatacatgccagatactctctacagccggctcaagagcgaaatg
aatccgttgagtcgccagcaggtgcgcaaatactcactgatgatgtttaagggcatggcc
tacctgcatgaggccggcattatgcatagggatattaagccagccaatttgttaattagt
cagacggatgtcctgaaaattgccgactttggtttggcgcgtctctattttcccgatgag
gaggcgcggctgtattcaccacaggtttccacgcgctggtatcgtgctccggaaatcctc
tggggcagtcaaaaatatggaacggccgttgacttatgggcctgtggcaatgtcctggcc
gagatgctgcgtggagtgccgctttttgcgggcaccacagacatcgaacaactggcgatt
ataattcgcaccttgggcagtccacgcttgaatgaatggcctgaactgacggcgctgccg
gattacagtaaaattagatttcccaattccgttggcatacattgggataatttatttccc
agttgcacgcatgctgtcgaaattgatctggtgtcaaatttggtcgtttacaatccgaag
aatcgtcttaaagccaccgaggccgttgagcatagttattttaattaa

DBGET integrated database retrieval system