KEGG   Drosophila grimshawi: Dgri_GH17446Help
Entry
Dgri_GH17446      CDS       T01061                                 

Definition
(RefSeq) GH17446 gene product from transcript GH17446-RA
  KO
K09566  peptidyl-prolyl isomerase G (cyclophilin G) [EC:5.2.1.8]
Organism
dgr  Drosophila grimshawi
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dgr03041]
    Dgri_GH17446
   03110 Chaperones and folding catalysts [BR:dgr03110]
    Dgri_GH17446
Enzymes [BR:dgr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Dgri_GH17446
Spliceosome [BR:dgr03041]
 Complex C
  Other components
   PPlases
    Dgri_GH17446
Chaperones and folding catalysts [BR:dgr03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    Dgri_GH17446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 6568542
NCBI-ProteinID: XP_001994815
FlyBase: FBgn0124916
UniProt: B4JTL5
AA seq 912 aa AA seqDB search
MTVNKRDASATRPRCFFDITLGGLSVGRIVFELFSDIAPKTVENFRSLCTGEKGTGLVTG
KRLHYKGVIFHRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDECFEKKHDRPFLLSMANR
GKNTNGSQFFITTQPAPHLDNIHVVFGHVLSGQDLVRQLEDLPIDRNSRPLQDAAIVNCG
ELVKQSKAKKEKKRRKRSTATEESGSENEQLVEAKQQRKDKAKKKRSHKESKSSDSENSD
SGRAVRGNGREEHHDEEGEIHPLVTITKIDPSEIPEVSNKFLMRAERSRSREDRGGGRDV
SREARQRERDHERDRERDERDRGRERNRNAFGWSKKQVPTSRSGRIVKGRGVFRFRTPSR
SRSKSITPPHWKHAQKRTIKLSDLERMEEENKMRDEEVRRREQERKKRHEEASKDPKKSY
FELSHASTYGGKVTPDKSSPSKQKRQPNSSSKDAAADRSKPAKETHEPPKEKEREKEKPP
KEEAPPKRRKSVDMNALDYEQQTDSEDSEPEEQASKQPMRKLSESKPAPAKVVEAAPENR
KKRDERKADDRHREPERSKRSRERSSSRNRNRSRSRSPQRRRSPARRQQQQQQRSPARQR
QSNNSHNNNNGSSNNNNNHNNNMTQSQFNRSRRNPFADRDRRQRSPDNEYRNRFPLSPIR
TRSSPAERRRSSRERQRSRGRRQASPGNRRRGGESPDRRRQESPVRKRQESPERRRRQES
PPPAPPRKRHDSRRDSVDRKRRDSPSRKRNASAERRRSRSRGRSSSRPRQRRSRDRSVAK
VAATAAAAAESEDKDKAAREKMQKRAEAALLLKEHMRKEIAKEEERRAEKQRQDELEKER
TTRELNELERLKAETLKKLQEEERAEQQQEQDASAAASRARRESRGSSHDTKKRKHKKSK
KQSTRSPRSDSD
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcaacaagcgggacgcgagtgcgacgcgaccgcgttgctttttcgacataacg
ctcggcggtttgagcgtcggtcgcatcgtctttgagctgtttagcgacattgcaccgaag
accgttgagaatttccgttcgctgtgcacgggcgaaaagggcaccggacttgtcaccggc
aagcgactccactacaaaggtgtcatcttccatcgcgtggtcaaggattttatggtgcag
gctggcgatttcagtgcgggcaacggcaccggcggcgaatcaatttatggcggcacattc
gaggacgagtgctttgagaagaagcacgatcgaccatttctgctgtcgatggcgaatcgt
ggcaagaacacaaacggttcgcagttctttattacaacacagcctgcgccacacttggac
aatatccatgttgtattcggtcatgttttatccggtcaggatttggtgcgtcaattagag
gatctgcccattgatcgcaattcgcgcccgctgcaggatgcggccatagtcaactgtggc
gaactggttaagcaatcaaaggcaaagaaggagaagaaacgcagaaagcgttcaacggcc
actgaggaatcaggcagcgagaacgagcagctggtggaggccaagcagcagcgcaaggac
aaagcaaagaagaagcgatcacacaaggagtccaaatccagcgacagtgaaaacagcgat
tcgggacgtgctgtgcgtggcaatggacgtgaggagcaccatgatgaggagggcgaaatt
catccgttggtcaccatcacaaaaatcgatcctagcgaaatacccgaggtgtcgaataaa
ttcctaatgcgtgccgagcgatcgcgttcccgcgaggatcgaggcggcggacgcgatgtg
tcacgcgaggcacgtcagcgtgaacgcgaccatgagcgggaccgtgaacgggacgagcgg
gatcggggcagggagcggaatcgcaatgcgtttggctggtcaaagaaacaggtgcccacc
tcacgcagtggtcgcatcgtcaagggacgcggtgtctttcgttttaggactccgtcgcgc
agtcgctcgaagagcataacgccgccgcattggaagcatgcgcagaagcgcaccattaag
ctgtcggatctggagcgcatggaggaggagaacaagatgcgagacgaggaggtgcggcgt
cgcgaacaggagcgcaaaaagcgccacgaggaggcctccaaggatccaaagaaatcgtac
tttgagctaagccatgccagcacctacggcggcaaagtgacaccagacaaatcatcgccg
tcgaaacagaaacggcagccgaacagcagcagcaaggatgctgctgcggaccgttcaaag
ccagcgaaggagacacacgagccgcccaaggagaaggagcgcgaaaaggagaagccgccc
aaagaggaggcgccgcccaagcgtcgcaaatcggtggacatgaacgccttggactacgaa
cagcagacggacagtgaggactcggagccggaggagcaagccagcaaacaacccatgcgc
aagctgagcgaatccaagccagcgccagcaaaggttgtcgaagcggcgccggaaaatcgc
aagaagcgcgacgagcgcaaagcagacgaccggcatcgcgagccggagagatcgaagcgc
agccgtgaacgttccagttcccgcaatcgcaacagaagtcgctcccgatccccgcaacgt
cgtcgctccccggcacgtcgccagcagcagcagcagcagcgttcgccagcccgccagcgg
cagagcaacaacagccacaacaacaataacggcagcagcaacaacaacaacaatcacaac
aacaacatgactcagagtcagttcaatcgcagccggcgcaatccgtttgcggatcgggat
cgtcgccagcgttcgccggacaacgagtaccgcaatcgcttcccgctgtcgcccatacga
acgcgcagctcgccggcggagcgacgccgcagctcccgagagcgccagcggagtcgggga
cggcggcaggcatcgcccggcaatcggaggcggggcggtgagtcgccggaccggagacgt
caggagtcgccggtgaggaagcgacaagagtcgcccgaacggagacgacgccaagaatcg
ccgccgccggcgccgccaaggaagcgccacgattcccgacgagattcagtcgatcgcaag
cgacgcgattcgcccagccgcaagcggaacgcgtccgccgagcgacgacgcagtcgcagt
cgtggcaggagcagcagccggccacgtcagcgtcgctcgcgggatcgcagtgtggcaaag
gtcgccgccaccgccgccgctgctgcggagtccgaggataaggataaggcggcacgcgag
aaaatgcagaagcgggcggaggcggcgctgctgctcaaggagcacatgcgcaaggagatc
gccaaggaggaggagcggcgcgcggagaagcagcgccaggatgagctggagaaggagcgt
accacgcgcgagctgaacgagctggagcgcctcaaggcggagacgctgaagaaactgcag
gaggaggagcgcgccgagcagcagcaggagcaggatgcgtcggcggcggcgagtcgagcg
aggcgcgaaagtcgcggcagcagccacgacaccaagaagcgcaagcataaaaagtccaag
aagcaatcgacgcgctcaccgcgctccgactcggattag

DBGET integrated database retrieval system