KEGG   Drosophila grimshawi: Dgri_GH17658Help
Entry
Dgri_GH17658      CDS       T01061                                 

Definition
(RefSeq) GH17658 gene product from transcript GH17658-RA
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00040  Pentose and glucuronate interconversions
dgr01100  Metabolic pathways
Module
dgr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dgri_GH17658
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     Dgri_GH17658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 RmlD_sub_bind Polysacc_synt_2 DUF1776 ADH_zinc_N UDPG_MGDP_dh_N NAD_binding_2 Shikimate_DH GDP_Man_Dehyd 3Beta_HSD 2-Hacid_dh_C ApbA NmrA PCMT F420_oxidored DUF3842
Motif
Other DBs
NCBI-GeneID: 6569491
NCBI-ProteinID: XP_001995635
FlyBase: FBgn0125128
UniProt: B4JX11
AA seq 242 aa AA seqDB search
MWSDLSNKVILVTGAGAGIGNALVKQLASAGATVIAVARNEAQLKELASVDAKHIKPLLV
DLTNWNKVREALATVPQLDGLVNNAGVAIIKPFEQLTEQDFDTQFDVNIKAVFNVTQTLL
PKLRNGSSIVNVSSIAASRSFGGHTAYSATKAALDSLTRSLALELGARKIRVNSVNPTVV
LTKMGRDNWSDPGKSGPLLAHIPLNRFCEVNEVTDAIGYLLSSKSSFVNGHQINLEGGYS
VS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtggagcgatctaagcaacaaggtgatactggtgaccggcgccggtgctggcattggc
aatgccctggtcaaacagttggccagcgccggtgccacagtcatcgcggtggcccgcaac
gaggcacagctcaaggaattggctagcgtggatgcgaagcatattaagccgctgctcgta
gatctaaccaattggaataaggtgcgcgaggcacttgcaactgtaccacagctggatgga
ctggtgaacaatgcgggcgtggccattatcaaacccttcgagcagctaaccgaacaggat
ttcgatactcagtttgatgtgaacattaaggctgtcttcaatgtgacgcagactctgctg
cccaagctgcgcaatggcagttcgattgtgaatgtgtcctcgatcgccgcatcccgtagt
tttggtggccacacggcatacagtgccacgaaagcggctctcgattcgttgaccagatcg
ttggctttggaattgggcgcacgcaaaatacgcgtcaattcggttaatcctactgttgtg
ctgaccaaaatgggccgcgacaattggtcagatccgggcaagagtgggccactgctggcg
cacataccactgaatcgattctgtgaggtgaacgaggtgaccgatgccattggctatctg
ctgagcagcaagtccagctttgtcaacggacatcagatcaatctcgagggcggctattcc
gtctcctaa

DBGET integrated database retrieval system