KEGG   Drosophila grimshawi: Dgri_GH18391Help
Entry
Dgri_GH18391      CDS       T01061                                 

Definition
(RefSeq) GH18391 gene product from transcript GH18391-RA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00010  Glycolysis / Gluconeogenesis
dgr00051  Fructose and mannose metabolism
dgr00562  Inositol phosphate metabolism
dgr01100  Metabolic pathways
dgr01200  Carbon metabolism
dgr01230  Biosynthesis of amino acids
Module
dgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dgr_M00002  Glycolysis, core module involving three-carbon compounds
dgr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgri_GH18391
   00051 Fructose and mannose metabolism
    Dgri_GH18391
   00562 Inositol phosphate metabolism
    Dgri_GH18391
Enzymes [BR:dgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dgri_GH18391
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dgri_GH18391
  Exosomal proteins of bladder cancer cells
   Dgri_GH18391
  Exosomal proteins of melanoma cells
   Dgri_GH18391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM Clathrin_bdg
Motif
Other DBs
NCBI-GeneID: 6563771
NCBI-ProteinID: XP_001990150
FlyBase: FBgn0125859
UniProt: B4JET1
AA seq 306 aa AA seqDB search
MDRNPTPTDLTLDAMKSVVSQAFLGKFTAVFPKLFKCQWKTYEGQKKLFANFNTDSNNMA
SRQFCVGGNWKMNGDQKSIAEICKVLSGAALDPSTQVVIGCPAIYLMQVRNLLPCSIGVA
GQNSYKVSKGAFTGEISPAMLKDVGVEWVILGHSERRAIFNESDELIAEKAEHALAEGLK
VIACIGESLQEREAGKTNDVVERQMAAYANKIKDWTNVVVAYEPVWAIGTGKTATPDQAQ
EVHAHLRKWLAEKISPQVSASLRIQYGGSVTGANAKELAKKPDIDGFLVGGASLKPEFVD
IINARQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggacagaaaccctacgccaactgacttaaccctagacgcaatgaagagcgttgtgtcg
caagcttttttgggtaaattcacagctgtttttccaaagcttttcaagtgccaatggaag
acatatgaaggtcagaagaagctctttgcgaatttcaacacagactcaaacaacatggca
agccgtcaattttgtgtgggtggcaactggaagatgaacggtgaccaaaagtcaattgct
gaaatctgcaaggtgctcagcggtgccgctctggatcccagcacgcaggtggtcatcggc
tgcccggccatctatctgatgcaggtgcgcaatctgctgccatgcagcatcggcgttgcc
ggccagaattcctataaggtcagcaagggcgccttcactggcgaaatttcacccgccatg
ctcaaggatgttggcgtcgaatgggtcattttgggccattcggagcgtcgcgccatcttc
aatgagtcggacgagctaattgccgagaaggctgagcatgctctggccgagggcctcaaa
gttattgcctgcattggcgagtcactgcaggagcgcgaggctggaaagacaaacgatgtg
gttgagcgccagatggccgcctatgccaacaaaatcaaggactggacaaatgtagtcgtc
gcctacgagcccgtctgggccattggcaccggcaagacagccacacccgatcaggcccaa
gaggtgcacgcccatctcaggaagtggctggctgaaaagatctcgccgcaggtgtctgcc
agtctgcgcattcagtacggtggctcggtgaccggcgccaatgccaaggaactggccaag
aagcccgacatcgatggtttccttgtcggtggcgcatcgctgaagccggagtttgtcgat
atcatcaatgcccgccagtaa

DBGET integrated database retrieval system