KEGG   Drosophila grimshawi: Dgri_GH18460Help
Entry
Dgri_GH18460      CDS       T01061                                 

Definition
(RefSeq) GH18460 gene product from transcript GH18460-RA
  KO
K12735  peptidyl-prolyl cis-trans isomerase-like 4 [EC:5.2.1.8]
Organism
dgr  Drosophila grimshawi
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dgr03041]
    Dgri_GH18460
   03110 Chaperones and folding catalysts [BR:dgr03110]
    Dgri_GH18460
Enzymes [BR:dgr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Dgri_GH18460
Spliceosome [BR:dgr03041]
 Complex C
  Other components
   PPlases
    Dgri_GH18460
Chaperones and folding catalysts [BR:dgr03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    Dgri_GH18460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 6563995
NCBI-ProteinID: XP_001990030
FlyBase: FBgn0125927
UniProt: B4JIL1
AA seq 582 aa AA seqDB search
MAVVIETTLGDLTVDLFMDERPIACLNFIKLCQLKYYNFNLFHTVQQGFIAQTGDPSGAG
DGGSSVWGVVEGSQKRFFEAEYIPKIHHSSAGMLSLVSVGKNLVGSQFFFTLGENLTSLD
GTHCVIGEVVEGHELLRKLNDAIVDESFRPYQDIRITHTVVLEDPFPNPRGFQIPARSPS
PSVERLQNGRIAADEDIDDTNGKTMEEMQEMLAEREAIARATILEIVGDLPDADMAPPEN
VLFVCKLNPVTTDDDLEIIFSRFGVVKGCEVIRDRKTGDSLQYAFVEFEDQKSCEAAYFK
MDNVLIDDRRIHVDFSQSVARVTWRGKGRGVIGADGKLDFNNLRDNGANNNGRKNESRTN
KRGRNEGRRDVRKPEEQRSRMGSAERRRARELRHQEQEGREDRSRNHNRQRSKSREPTER
HRERSDRRRSRSRDRNERRRATSPYRGNRYSPERRRQEDRHNRSSRDRQQRSAFRVQENS
QSERRNIERKSKEERSENTQNDRKRLAVERESKFKKKSKRAKSSSTESSDSSDDTESSSD
SSEDSSSSTSSDERSKRKKSSKSKHKKTKTKSKHKSKKKHKK
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggttattgagaccacgctgggtgacttgactgttgatctatttatggacgag
cgaccgattgcgtgccttaacttcatcaagctctgccagttgaaatactacaacttcaat
ctattccacacggttcagcagggattcattgcccagactggggatcctagtggcgccggt
gatggcggctcatccgtgtggggcgttgtggagggctcccagaagcgtttctttgaggcc
gaatacataccgaaaatccaccattcgagtgccggtatgctctctttggtgagtgtcggc
aaaaacctcgttggctcccagtttttctttacgctcggcgagaatttgacttccttggac
ggcacccattgtgtcattggtgaagtggtggagggacacgaactgctgcggaagctgaac
gatgccattgtggacgagagctttcgtccctatcaagatattcgcataacgcacacagtc
gttctggaagatccgtttcccaatcctcgtggctttcagatacccgcccgttcaccgtct
cccagcgtggaaaggcttcaaaatggtcgcatcgctgccgacgaggacattgacgacacc
aacggcaagaccatggaggagatgcaagagatgctcgcagaacgggaggccatagcacgt
gctacaatcttggaaattgtgggcgatctgccggatgcggacatggcgccaccggaaaac
gtgctattcgtgtgcaagctcaatcctgtaacaaccgacgacgacttggagatcattttt
agtcgctttggcgttgtgaagggctgcgaagtgatacgcgaccggaagacaggcgactcc
ttgcagtacgcttttgtcgagttcgaggatcagaagtcctgcgaagcggcctatttcaaa
atggacaatgtgctcatcgacgatcgacgcatccacgtggacttctcgcagtcggtggcc
cgggtgacttggcggggcaaaggccgaggcgttattggtgccgatggcaaattggacttt
aacaatctacgagacaatggtgccaataacaatggacggaaaaatgagagtagaaccaac
aaaaggggtcgcaatgaaggacgaagggatgtacgaaaacctgaagagcaacggagccga
atgggctctgctgaacgcagaagggctcgcgaattacgacatcaagagcaagagggccgt
gaggatcgctcccgtaaccataatcgacaacgttcaaaatcaagagaacccactgaacgc
cacagggaacgaagcgatcggcgacgctcccgatcgagggacagaaacgagcgaagaagg
gcaacgtctccttaccgaggcaatcgttattcgccggagcgaagacgtcaagaagatcgt
cataatcgcagtagtagagatcgacagcaaagatccgcgtttcgagtacaggaaaactca
caaagcgaacgacgaaacattgaaagaaaatcgaaggaggaacgctcggaaaacacccaa
aacgatcgaaaacgtttagctgtggagagggagagtaaatttaagaagaaatctaaacgt
gccaagagcagcagtacggaatctagcgattcctccgatgacactgaatcgtcatctgac
agttcggaggatagctcctcctccacatcctcagatgagcgtagcaagcgcaagaagagt
agcaagtcgaagcataagaagaccaagacaaagagcaaacacaagtcaaagaaaaagcac
aagaaataa

DBGET integrated database retrieval system