KEGG   Drosophila grimshawi: Dgri_GH18586Help
Entry
Dgri_GH18586      CDS       T01061                                 

Definition
(RefSeq) GH18586 gene product from transcript GH18586-RA
  KO
K22823  non-structural maintenance of chromosomes element 3
Organism
dgr  Drosophila grimshawi
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dgr03400]
    Dgri_GH18586
DNA repair and recombination proteins [BR:dgr03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     Dgri_GH18586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAGE
Motif
Other DBs
NCBI-GeneID: 6564083
NCBI-ProteinID: XP_001989823
FlyBase: FBgn0126053
UniProt: B4JHX7
AA seq 267 aa AA seqDB search
MASTSRNASRGRNTAVSQSQVESWPVEIDNQVRAMLNFILCHSANKVPIKLNDLMPLAEN
KNELNKRIPIVSKLLEERYGIKLIQLEGTPKRYICVSEMPATSIFEITAAQRPQFTLLYI
ILTYIFLRGNRIEENKLYDMLDMLEVNVHEEHGYFGANISKLIEDTFVKQQYLKRERSQL
SSYDDLKISYTWGPRAKSEFTYEQIVQFASKLFDQDVAFFQKQLMMAEGIDNPEMLEHIS
MASVNNAETSYIDLKSEHTNSIDTDSQ
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacctctcggaatgcctcacggggcagaaatacagcagtttcgcaatcccag
gtggaatcatggcccgtggaaatcgacaaccaagtgcgggccatgctcaatttcattcta
tgccattcggccaataaagtgcccatcaaattaaatgatttgatgcccctggcggaaaac
aaaaacgagttaaataagcggattccgattgtaagcaaactactcgaagaacgctatgga
atcaagctcattcagcttgagggaacacctaagagatatatctgcgtatccgagatgccg
gcgacgtccatattcgaaattacggccgcacaacggccccaatttacattgttgtacatt
atattgacgtacatctttttacgcggcaatcggattgaggagaataaactctatgacatg
ctggacatgttggaagtcaacgtgcacgaggagcatggatattttggggcgaacatatcc
aaactaatcgaagatacgttcgtgaagcagcagtatctgaagcgagagcgctcacagctc
agctcctatgatgatctcaagattagctacacttggggaccacgggccaaatccgagttt
acctatgagcaaattgtccagttcgcatccaagttgttcgaccaggacgtcgccttcttt
cagaaacagcttatgatggctgagggcatcgataatcccgagatgttggaacatatttcg
atggccagcgtcaataacgccgaaacaagctatattgacttaaaatcagagcacacaaac
tcaatagatactgatagccaataa

DBGET integrated database retrieval system