KEGG   Drosophila grimshawi: Dgri_GH18598Help
Entry
Dgri_GH18598      CDS       T01061                                 

Definition
(RefSeq) GH18598 gene product from transcript GH18598-RA
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00780  Biotin metabolism
dgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Dgri_GH18598
Enzymes [BR:dgr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     Dgri_GH18598
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     Dgri_GH18598
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     Dgri_GH18598
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     Dgri_GH18598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_C BPL_LplA_LipB BPL_N
Motif
Other DBs
NCBI-GeneID: 6563879
NCBI-ProteinID: XP_001989799
FlyBase: FBgn0126065
UniProt: B4JHV3
AA seq 980 aa AA seqDB search
MLTLYYVSATLMQSWRIQRACNKIAEQLAQSSSIAFYALQAGHDDGFDATIASSELCANR
NAAKVTDILWLHGNQHGCCLRPLQTVRITPWISFPAAPSWLPFDYAADALTPTATPTDIE
PQPRITLSADKTQHLQLLLEAQVERDAAAHFVPVRLENYGKLIAWKIDSHLAVLIETDVE
HFTQLLIMTFLQNNLYINDQLPLIRIESVQGEGQPQPFELLANHLKRQSRNSAEISPEGW
QKHLEDLRGLCVLAHQAIEFEQQKNRTELKASAPKQEPIVQPPAAVQSSVKAVAVVEPTT
KKTTPAKPTKLKQPATAENLLSKPREVEKTPTTMPAAESSQESKSAQASKTSTPSKSFVA
VKPNSPPSESAASTSRKRPILQRNKNSLGECKPLNVLVYSDSASARDSAIATLRQLLESD
VYTIYPLTPQQAGQKHWIEQTALLVVCGSVPPNIGQILVDYFLHGGKVLSLCSDILHFIL
PNYRTAEVREHELVQFSYDKWQRVKMMHHIFCYQPSPVKKNFSTDSEESSVPSHSRTPSM
DLKDLAGQTHKLDVKVLGTEETWNTPSLMLANSLQSGGKAVFSQVHLETNPSEFEFDEDK
FSILKQSEPTRIEIFTDLLRKYLDVQVRSSDAVASAVPGVVFKQAYFLGRHESKFELLEK
LRPRCSGPDDVIVTPKLTIKFCGKDDKAPVANTNVLPIIIHSCPDDFSTVDYFDNLKTEH
IGRLVIYVPIISSSMHVIQDLELMHGIAVLPVQQTAGVGRSNNQWLSPVGCAMFSTQLHI
PMDTPLGSRLSLIQHIIGAAIVNTLRGHKLYRVLDIALKWPNDIIANGNIKIGGLVVNTT
LLGSQALVNIGSGINLNNSKPTICINDMIKEYNARMPIAKLPLLKYEQFIALIFNEIEGI
LAEVQNGDFKHFYALYYDLWLHSEQSVKIFLENQEKDAKIIGIDDAGFLKVKLANGTIET
VQPDGNSFDMLKGLIVPKYN
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccctgtattacgtgagcgctactttgatgcaatcctggcgaattcaaagggcc
tgcaacaaaattgccgagcagttggcgcaatcgtcgagcattgcattctatgcgctccaa
gctggccatgacgatggcttcgatgcgacaattgccagttcggagctgtgtgctaatcgt
aatgcggccaaggttacggatattttgtggctgcatggcaatcaacacggttgctgcctg
cgtccattgcaaacggtgcgcataacgccatggatcagttttccagcggcgcccagttgg
ctgccatttgactatgccgccgatgccttgacgcccacagcgacaccaacggacattgaa
ccgcagccgcgcataactctgtcggcggacaagacacaacatttgcaattgttgctcgag
gctcaggtagaacgggatgcggccgcacacttcgttccggttcggctggaaaattacggt
aagctaatcgcatggaaaatagactcccacctggcggtgctcatcgagacggacgttgag
cacttcacacaactattgataatgacatttttacaaaacaatttatatataaacgatcag
ttgccacttataaggattgagtctgtgcagggcgagggacaaccgcagcccttcgagctg
ctggccaatcatctgaagcgtcaatcgcgcaactcagctgaaattagtccagagggctgg
cagaagcatttggaggatttacgtggtctctgcgtattagctcaccaggcaatcgaattc
gagcagcaaaagaatcgtaccgaactcaaggctagtgctcccaaacaggagccaatagtc
cagccgcctgcagcagtacagagcagtgtgaaggccgtggctgttgtggaacccaccacc
aagaaaacaactcctgccaagcccacaaagctaaagcagccggcgacagctgaaaatcta
ttgagcaagccgcgtgaagtggaaaaaaccccaaccaccatgccagcagcagaatccagc
caagaatcgaaatccgcacaagcgtcgaaaacatcgacgcccagcaagagttttgtggcc
gttaaaccgaattcgccaccatcggaatccgccgcttcaacatcccgaaagcgtcccatt
ttgcagcggaataagaatagcctgggtgaatgtaaaccgcttaatgtgctcgtctattcg
gacagcgcaagtgcccgggattctgcaatagcaacacttcgtcagctccttgagtcggat
gtgtacaccatttatccgctgacaccgcagcaggcggggcaaaagcattggattgagcag
acggcgctgctcgttgtttgtggatcagtaccaccaaacattggccagatacttgtcgat
tattttctgcatggcggcaaggtcttgagtctctgctcggatatcttgcacttcatattg
cccaattatcgcacggctgaggttcgagagcacgaattggttcagttttcctatgacaaa
tggcagcgggtgaagatgatgcatcacattttctgctaccagccttctcccgttaagaag
aacttctctacggatagcgaggagtcgtcggttccgtcgcattcgcgtacaccgtccatg
gatttgaaggatctcgccgggcagacacacaaattggatgttaaagttttgggcactgag
gagacgtggaacacgccaagtctaatgctggccaacagtttgcaaagtggcggcaaggcc
gtcttctcgcaggtgcatctggagacaaatcccagtgagtttgagtttgatgaggataaa
ttttcgattctaaagcaaagcgaacccacacgcatcgagatctttacggatctcctgcgt
aagtatctggatgtccaggtgcgaagcagtgatgcagtggcatccgccgtgcccggagtt
gtctttaagcaggcctacttcctgggtcgccatgagtctaaatttgagttgttggagaag
ctgcgtccacgttgtagcggccctgacgatgtcatagtgacgcccaagctaaccattaaa
ttctgtgggaaagacgataaggcgcccgttgcgaacacaaatgtgctgcccattataata
cattcctgcccagatgatttctccacggttgactactttgataacttaaaaaccgagcat
attggacgcctggtcatctatgtgcccatcataagcagttccatgcatgtcatccaagat
ctggagctgatgcacggtattgctgtgctgcctgtccaacaaactgcgggcgtgggccgc
agcaataatcagtggctgagtccagttggctgtgcaatgttctccactcagctgcacatt
cccatggacaccccgttgggatcgcgtctatccttgatccagcatataattggagccgca
attgtgaacactctgcgaggtcataaactgtatagggtactcgatattgctctaaaatgg
ccaaatgatattattgccaacggtaacataaaaattggtggactagtcgtcaataccacc
ttattaggctcgcaggcattggtgaatattggcagcggaattaatttaaacaactcaaaa
ccaacaatttgcattaacgatatgataaaagagtataatgcgcggatgcccattgctaaa
ttaccattactgaaatatgagcaatttattgcattaatttttaatgaaatcgaaggaatt
ttggctgaagtccagaacggagatttcaaacatttctacgccttgtactacgacctttgg
ctgcatagcgagcaaagcgttaagattttcctggaaaatcaagaaaaggatgccaagatt
attggcatcgatgatgcaggtttcttgaaagtaaaattagcgaatggaacgattgagacc
gttcaacccgatggcaacagttttgatatgctgaagggattaatagtacctaaatacaat
taa

DBGET integrated database retrieval system